Homologs in group_2585

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_03355 EHELCC_03355 100.0 Morganella morganii S2 acrR DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA
NLDBIP_00105 NLDBIP_00105 100.0 Morganella morganii S4 acrR DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA
LHKJJB_01930 LHKJJB_01930 100.0 Morganella morganii S3 acrR DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA
HKOGLL_01970 HKOGLL_01970 100.0 Morganella morganii S5 acrR DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA
F4V73_RS05330 F4V73_RS05330 77.0 Morganella psychrotolerans - TetR/AcrR family transcriptional regulator

Distribution of the homologs in the orthogroup group_2585

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2585

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0ACT9 7.89e-23 93 31 5 192 3 uidR HTH-type transcriptional regulator UidR Shigella flexneri
P0ACT6 7.89e-23 93 31 5 192 1 uidR HTH-type transcriptional regulator UidR Escherichia coli (strain K12)
P0ACT7 7.89e-23 93 31 5 192 3 uidR HTH-type transcriptional regulator UidR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACT8 7.89e-23 93 31 5 192 3 uidR HTH-type transcriptional regulator UidR Escherichia coli O157:H7
O53165 7.49e-10 58 26 2 160 1 Rv1474c HTH-type transcriptional repressor Rv1474c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q66D52 9.9e-07 50 28 4 142 3 betI HTH-type transcriptional regulator BetI Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TNP0 9.9e-07 50 28 4 142 3 betI HTH-type transcriptional regulator BetI Yersinia pestis (strain Pestoides F)
Q1CFR9 9.9e-07 50 28 4 142 3 betI HTH-type transcriptional regulator BetI Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZGV8 9.9e-07 50 28 4 142 3 betI HTH-type transcriptional regulator BetI Yersinia pestis
B2K8U6 9.9e-07 50 28 4 142 3 betI HTH-type transcriptional regulator BetI Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C930 9.9e-07 50 28 4 142 3 betI HTH-type transcriptional regulator BetI Yersinia pestis bv. Antiqua (strain Antiqua)
A7FKL4 9.9e-07 50 28 4 142 3 betI HTH-type transcriptional regulator BetI Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
P0ACT1 2.14e-06 49 36 0 66 3 acrR HTH-type transcriptional regulator AcrR Shigella flexneri
P0ACS9 2.14e-06 49 36 0 66 1 acrR HTH-type transcriptional regulator AcrR Escherichia coli (strain K12)
P0ACT0 2.14e-06 49 36 0 66 3 acrR HTH-type transcriptional regulator AcrR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P95251 2.61e-06 50 34 0 61 1 mce3R Transcriptional repressor Mce3R Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q8X4Z7 4.56e-06 48 37 2 81 3 rutR HTH-type transcriptional regulator RutR Escherichia coli O157:H7
P0ACU4 4.74e-06 48 37 2 81 3 rutR HTH-type transcriptional regulator RutR Shigella flexneri
P0ACU2 4.74e-06 48 37 2 81 1 rutR HTH-type transcriptional regulator RutR Escherichia coli (strain K12)
P0ACU3 4.74e-06 48 37 2 81 3 rutR HTH-type transcriptional regulator RutR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A0R4Z6 5.12e-06 48 28 7 150 1 kstR2 HTH-type transcriptional repressor KstR2 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q65R67 7.06e-06 48 25 8 169 3 slmA Nucleoid occlusion factor SlmA Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q6LVN6 7.54e-06 48 27 9 172 3 slmA Nucleoid occlusion factor SlmA Photobacterium profundum (strain SS9)
O31560 1.07e-05 47 24 5 178 1 yfiR Uncharacterized HTH-type transcriptional regulator YfiR Bacillus subtilis (strain 168)
A8GBX7 1.39e-05 47 26 4 163 3 betI HTH-type transcriptional regulator BetI Serratia proteamaculans (strain 568)
P17446 1.48e-05 47 37 0 53 2 betI HTH-type transcriptional regulator BetI Escherichia coli (strain K12)
B1J0W4 1.48e-05 47 37 0 53 3 betI HTH-type transcriptional regulator BetI Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
B1XET8 1.48e-05 47 37 0 53 3 betI HTH-type transcriptional regulator BetI Escherichia coli (strain K12 / DH10B)
Q1RFM1 1.52e-05 47 37 0 53 3 betI HTH-type transcriptional regulator BetI Escherichia coli (strain UTI89 / UPEC)
Q0TKV9 1.52e-05 47 37 0 53 3 betI HTH-type transcriptional regulator BetI Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7MCD2 1.52e-05 47 37 0 53 3 betI HTH-type transcriptional regulator BetI Escherichia coli O45:K1 (strain S88 / ExPEC)
B6I093 1.73e-05 47 37 0 53 3 betI HTH-type transcriptional regulator BetI Escherichia coli (strain SE11)
B7M2V7 1.73e-05 47 37 0 53 3 betI HTH-type transcriptional regulator BetI Escherichia coli O8 (strain IAI1)
Q8FKI7 1.76e-05 47 37 0 53 3 betI HTH-type transcriptional regulator BetI Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B7UJG6 1.76e-05 47 37 0 53 3 betI HTH-type transcriptional regulator BetI Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q0T7M8 1.8e-05 47 37 0 53 3 betI HTH-type transcriptional regulator BetI Shigella flexneri serotype 5b (strain 8401)
B7N8L5 1.8e-05 47 37 0 53 3 betI HTH-type transcriptional regulator BetI Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
A7ZWV6 1.8e-05 47 37 0 53 3 betI HTH-type transcriptional regulator BetI Escherichia coli O9:H4 (strain HS)
B7NK49 1.8e-05 47 37 0 53 3 betI HTH-type transcriptional regulator BetI Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7L442 1.8e-05 47 37 0 53 3 betI HTH-type transcriptional regulator BetI Escherichia coli (strain 55989 / EAEC)
A7ZI52 1.8e-05 47 37 0 53 3 betI HTH-type transcriptional regulator BetI Escherichia coli O139:H28 (strain E24377A / ETEC)
B5Z1R2 1.92e-05 47 37 0 53 3 betI HTH-type transcriptional regulator BetI Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X6C3 1.92e-05 47 37 0 53 3 betI HTH-type transcriptional regulator BetI Escherichia coli O157:H7
B1LIJ9 1.98e-05 47 37 0 53 3 betI HTH-type transcriptional regulator BetI Escherichia coli (strain SMS-3-5 / SECEC)
B5Y006 2.12e-05 46 38 0 50 3 betI HTH-type transcriptional regulator BetI Klebsiella pneumoniae (strain 342)
Q7MY26 2.4e-05 46 26 7 172 3 slmA Nucleoid occlusion factor SlmA Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q4JVM3 2.82e-05 46 22 3 171 3 acnR HTH-type transcriptional repressor AcnR Corynebacterium jeikeium (strain K411)
P94548 2.89e-05 46 27 5 156 1 fadR Fatty acid metabolism regulator protein Bacillus subtilis (strain 168)
O34643 2.99e-05 46 32 0 61 4 yvkB Uncharacterized HTH-type transcriptional regulator YvkB Bacillus subtilis (strain 168)
Q88N29 5.28e-05 45 22 4 185 3 ttgR Probable HTH-type transcriptional regulator TtgR Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q9KJC4 5.28e-05 45 22 4 185 3 arpR Probable HTH-type transcriptional regulator ArpR Pseudomonas putida
Q0S7V2 6.07e-05 45 31 0 57 1 kstR2 HTH-type transcriptional repressor KstR2 Rhodococcus jostii (strain RHA1)
B7VHK0 6.59e-05 45 26 10 175 3 slmA Nucleoid occlusion factor SlmA Vibrio atlanticus (strain LGP32)
Q9L4K2 7.67e-05 45 26 6 173 3 betI2 HTH-type transcriptional regulator BetI 2 Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
P40950 9.9e-05 45 33 2 75 4 yuxN Uncharacterized HTH-type transcriptional regulator YuxN Bacillus subtilis (strain 168)
O07001 0.000134 44 41 0 53 1 yvdT Uncharacterized HTH-type transcriptional regulator YvdT Bacillus subtilis (strain 168)
P29280 0.000158 44 25 7 177 3 slmA Nucleoid occlusion factor SlmA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UI96 0.000158 44 25 7 177 3 slmA Nucleoid occlusion factor SlmA Haemophilus influenzae (strain PittGG)
A5UDB3 0.000158 44 25 7 177 3 slmA Nucleoid occlusion factor SlmA Haemophilus influenzae (strain PittEE)
Q4QLV2 0.000158 44 25 7 177 3 slmA Nucleoid occlusion factor SlmA Haemophilus influenzae (strain 86-028NP)
Q7MPT0 0.000269 43 25 10 175 3 slmA Nucleoid occlusion factor SlmA Vibrio vulnificus (strain YJ016)
Q8DDX7 0.000269 43 25 10 175 3 slmA Nucleoid occlusion factor SlmA Vibrio vulnificus (strain CMCP6)
P9WMB9 0.000291 43 21 2 155 1 kstR2 HTH-type transcriptional repressor KstR2 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WMB8 0.000291 43 21 2 155 3 kstR2 HTH-type transcriptional repressor KstR2 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A7MFA6 0.000322 43 34 0 50 3 betI HTH-type transcriptional regulator BetI Cronobacter sakazakii (strain ATCC BAA-894)
Q63KK9 0.000327 43 25 4 146 3 betI HTH-type transcriptional regulator BetI Burkholderia pseudomallei (strain K96243)
A3NKP7 0.000327 43 25 4 146 3 betI HTH-type transcriptional regulator BetI Burkholderia pseudomallei (strain 668)
Q3JLL9 0.000327 43 25 4 146 3 betI HTH-type transcriptional regulator BetI Burkholderia pseudomallei (strain 1710b)
A3P6A9 0.000327 43 25 4 146 3 betI HTH-type transcriptional regulator BetI Burkholderia pseudomallei (strain 1106a)
Q62CH6 0.000327 43 25 4 146 3 betI HTH-type transcriptional regulator BetI Burkholderia mallei (strain ATCC 23344)
A2RWD7 0.000327 43 25 4 146 3 betI HTH-type transcriptional regulator BetI Burkholderia mallei (strain NCTC 10229)
A3MEC5 0.000327 43 25 4 146 3 betI HTH-type transcriptional regulator BetI Burkholderia mallei (strain NCTC 10247)
Q7VN48 0.000334 43 24 2 98 3 slmA Nucleoid occlusion factor SlmA Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q9AIU0 0.000346 43 21 4 185 1 ttgR HTH-type transcriptional regulator TtgR Pseudomonas putida (strain DOT-T1E)
C3K3D1 0.000355 43 26 4 137 3 betI HTH-type transcriptional regulator BetI Pseudomonas fluorescens (strain SBW25)
Q9KVD2 0.000366 43 26 9 173 1 slmA Nucleoid occlusion factor SlmA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8NQ97 0.000382 43 23 3 167 1 acnR HTH-type transcriptional repressor AcnR Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
P0A0N5 0.000446 42 34 0 55 1 qacR HTH-type transcriptional regulator QacR Staphylococcus haemolyticus
P0A0N4 0.000446 42 34 0 55 1 qacR HTH-type transcriptional regulator QacR Staphylococcus aureus
P0A0N3 0.000446 42 34 0 55 1 qacR HTH-type transcriptional regulator QacR Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6VSX5 0.000447 43 23 5 178 3 slmA Nucleoid occlusion factor SlmA Marinomonas sp. (strain MWYL1)
Q87T90 0.000493 42 27 9 172 3 slmA Nucleoid occlusion factor SlmA Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q1QXD9 0.000529 42 25 6 175 3 betI1 HTH-type transcriptional regulator BetI 1 Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
A7MSP5 0.000543 42 27 9 173 3 slmA Nucleoid occlusion factor SlmA Vibrio campbellii (strain ATCC BAA-1116)
Q9CLQ9 0.000587 42 27 5 135 3 slmA Nucleoid occlusion factor SlmA Pasteurella multocida (strain Pm70)
P0C068 0.000831 42 21 4 185 3 mepR Probable HTH-type transcriptional regulator MepR Pseudomonas putida
Q8FTA6 0.000899 42 31 0 60 3 acnR HTH-type transcriptional repressor AcnR Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
O33453 0.001 42 27 3 111 2 cymR HTH-type transcriptional regulator CymR Pseudomonas putida

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_02885
Feature type CDS
Gene acrR
Product DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA
Location 270943 - 271533 (strand: -1)
Length 591 (nucleotides) / 196 (amino acids)

Contig

Accession contig_2
Length 292399 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2585
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF00440 Bacterial regulatory proteins, tetR family
PF13977 BetI-type transcriptional repressor, C-terminal

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1309 Transcription (K) K DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K16138 TetR/AcrR family transcriptional regulator, repressor for uid operon - -

Protein Sequence

MEKLTEKQQRKRRQILDAAMHCFIEKGFHSTSTAEICKAAGMSPGNLFHYYPTKYAIIEAIAELDEDDHKAILSIGDAPGHTADIIEKMITALIMLYSEPGYTRLSLEIITEASRNPELNAAFVVNEQRLHKKFCDVLRRGMAAGEIDPQLDPAQTASWLLVMADGTLGRELTEPEFSREAFLCGLRVLLRKALKP

Flanking regions ( +/- flanking 50bp)

AGAGTAATCAGTCTAATTTCTATTATCCGGTTTTTCGGAGACACTTCCTTATGGAAAAATTAACGGAAAAGCAGCAGCGCAAACGTCGTCAGATCCTTGACGCTGCAATGCATTGTTTTATCGAAAAAGGTTTTCATTCCACCTCGACGGCGGAGATTTGTAAAGCCGCCGGGATGAGCCCCGGGAATCTGTTTCATTACTATCCGACTAAATACGCCATCATTGAAGCGATTGCGGAACTGGACGAGGATGACCACAAGGCGATTCTGAGTATCGGTGATGCGCCGGGACATACGGCAGATATTATTGAAAAAATGATAACGGCGTTGATTATGTTGTATAGCGAACCGGGTTATACCCGCCTCAGTCTGGAAATTATCACCGAGGCAAGCCGTAACCCTGAGCTGAATGCAGCTTTTGTTGTTAATGAGCAGCGGCTGCACAAAAAATTCTGTGATGTGCTCAGACGCGGCATGGCCGCAGGAGAGATTGACCCGCAGCTGGATCCGGCACAGACGGCGTCCTGGCTGCTGGTGATGGCGGACGGCACGCTGGGGCGTGAACTGACGGAACCTGAGTTCAGCCGGGAGGCGTTTCTCTGCGGGTTACGTGTGTTGCTGAGAAAGGCGCTGAAGCCCTGAATTACGCTTCGCTGACAGTCCGCTGCATCACCGTGACCAGTTCGTCATTG