Homologs in group_2563

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_02885 EHELCC_02885 100.0 Morganella morganii S2 - hypothetical protein
NLDBIP_00575 NLDBIP_00575 100.0 Morganella morganii S4 - hypothetical protein
LHKJJB_01460 LHKJJB_01460 100.0 Morganella morganii S3 - hypothetical protein
HKOGLL_01500 HKOGLL_01500 100.0 Morganella morganii S5 - hypothetical protein
F4V73_RS19305 F4V73_RS19305 83.3 Morganella psychrotolerans - hypothetical protein

Distribution of the homologs in the orthogroup group_2563

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2563

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_02415
Feature type CDS
Gene -
Product hypothetical protein
Location 177660 - 177824 (strand: 1)
Length 165 (nucleotides) / 54 (amino acids)
In genomic island -

Contig

Accession contig_2
Length 292399 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2563
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Protein Sequence

MAENTTSGKIPPEKPVQDEKQEAVNTGRPADKSCPSLPFSYLRRALRNKVGKHE

Flanking regions ( +/- flanking 50bp)

ACGGAAAATAGAAGCGGTTAACGACGCGCTGAGTAAAGAAGGGGAATAATATGGCGGAAAACACCACCTCCGGAAAAATCCCGCCGGAAAAGCCGGTTCAGGATGAAAAACAGGAAGCGGTGAACACCGGCAGGCCCGCAGATAAGTCGTGTCCCAGCTTACCGTTTTCCTATTTACGCCGCGCCTTGCGCAATAAGGTCGGCAAACACGAATAACCGGGGCGCAGCGAATGCGCCCGGGTCGTGCAAAAAAATCAGCGTGATTT