Homologs in group_673

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_02415 FBDBKF_02415 100.0 Morganella morganii S1 - hypothetical protein
NLDBIP_00575 NLDBIP_00575 100.0 Morganella morganii S4 - hypothetical protein
LHKJJB_01460 LHKJJB_01460 100.0 Morganella morganii S3 - hypothetical protein
HKOGLL_01500 HKOGLL_01500 100.0 Morganella morganii S5 - hypothetical protein
F4V73_RS19305 F4V73_RS19305 83.3 Morganella psychrotolerans - hypothetical protein
PMI_RS19445 PMI_RS19445 43.2 Proteus mirabilis HI4320 - hypothetical protein

Distribution of the homologs in the orthogroup group_673

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_673

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_02885
Feature type CDS
Gene -
Product hypothetical protein
Location 565480 - 565644 (strand: 1)
Length 165 (nucleotides) / 54 (amino acids)

Contig

Accession ZDB_213
Length 680219 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_673
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Protein Sequence

MAENTTSGKIPPEKPVQDEKQEAVNTGRPADKSCPSLPFSYLRRALRNKVGKHE

Flanking regions ( +/- flanking 50bp)

ACGGAAAATAGAAGCGGTTAACGACGCGCTGAGTAAAGAAGGGGAATAATATGGCGGAAAACACCACCTCCGGAAAAATCCCGCCGGAAAAGCCGGTTCAGGATGAAAAACAGGAAGCGGTGAACACCGGCAGGCCCGCAGATAAGTCGTGTCCCAGCTTACCGTTTTCCTATTTACGCCGCGCCTTGCGCAATAAGGTCGGCAAACACGAATAACCGGGGCGCAGCGAATGCGCCCGGGTCGTGCAAAAAAATCAGCGTGATTT