Homologs in group_718

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_02590 EHELCC_02590 100.0 Morganella morganii S2 mdtI multidrug/spermidine efflux SMR transporter subunit MdtI
NLDBIP_00870 NLDBIP_00870 100.0 Morganella morganii S4 mdtI multidrug/spermidine efflux SMR transporter subunit MdtI
LHKJJB_01165 LHKJJB_01165 100.0 Morganella morganii S3 mdtI multidrug/spermidine efflux SMR transporter subunit MdtI
HKOGLL_01205 HKOGLL_01205 100.0 Morganella morganii S5 mdtI multidrug/spermidine efflux SMR transporter subunit MdtI
F4V73_RS04485 F4V73_RS04485 96.4 Morganella psychrotolerans mdtI multidrug/spermidine efflux SMR transporter subunit MdtI
PMI_RS05595 PMI_RS05595 86.4 Proteus mirabilis HI4320 mdtI multidrug/spermidine efflux SMR transporter subunit MdtI

Distribution of the homologs in the orthogroup group_718

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_718

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7N536 1.08e-57 176 81 0 109 3 mdtI Spermidine export protein MdtI Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A1JRE5 1.98e-53 165 77 0 109 3 mdtI Spermidine export protein MdtI Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B1JLJ7 2.72e-51 160 77 0 109 3 mdtI Spermidine export protein MdtI Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A4TJI9 2.72e-51 160 77 0 109 3 mdtI Spermidine export protein MdtI Yersinia pestis (strain Pestoides F)
Q1CJF4 2.72e-51 160 77 0 109 3 mdtI Spermidine export protein MdtI Yersinia pestis bv. Antiqua (strain Nepal516)
A9QYW1 2.72e-51 160 77 0 109 3 mdtI Spermidine export protein MdtI Yersinia pestis bv. Antiqua (strain Angola)
Q0WF87 2.72e-51 160 77 0 109 3 mdtI Spermidine export protein MdtI Yersinia pestis
Q1C803 2.72e-51 160 77 0 109 3 mdtI Spermidine export protein MdtI Yersinia pestis bv. Antiqua (strain Antiqua)
A7FIB4 2.72e-51 160 77 0 109 3 mdtI Spermidine export protein MdtI Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q66AS8 4.31e-51 159 76 0 109 3 mdtI Spermidine export protein MdtI Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K337 4.31e-51 159 76 0 109 3 mdtI Spermidine export protein MdtI Yersinia pseudotuberculosis serotype IB (strain PB1/+)
P0C7H7 2.02e-46 147 71 0 109 3 mdtI Spermidine export protein MdtI Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q7CQK0 8.88e-46 146 70 0 109 3 mdtI Spermidine export protein MdtI Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XG16 8.88e-46 146 70 0 109 3 mdtI Spermidine export protein MdtI Salmonella typhi
B4TVE9 8.88e-46 146 70 0 109 3 mdtI Spermidine export protein MdtI Salmonella schwarzengrund (strain CVM19633)
C0Q4Y4 8.88e-46 146 70 0 109 3 mdtI Spermidine export protein MdtI Salmonella paratyphi C (strain RKS4594)
A9MZZ2 8.88e-46 146 70 0 109 3 mdtI Spermidine export protein MdtI Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4T5B9 8.88e-46 146 70 0 109 3 mdtI Spermidine export protein MdtI Salmonella newport (strain SL254)
B4THR4 8.88e-46 146 70 0 109 3 mdtI Spermidine export protein MdtI Salmonella heidelberg (strain SL476)
B5QUE3 8.88e-46 146 70 0 109 3 mdtI Spermidine export protein MdtI Salmonella enteritidis PT4 (strain P125109)
B5FHS1 8.88e-46 146 70 0 109 3 mdtI Spermidine export protein MdtI Salmonella dublin (strain CT_02021853)
Q57PF4 8.88e-46 146 70 0 109 3 mdtI Spermidine export protein MdtI Salmonella choleraesuis (strain SC-B67)
B5F6G3 8.88e-46 146 70 0 109 3 mdtI Spermidine export protein MdtI Salmonella agona (strain SL483)
A9MRT8 1.71e-45 145 67 0 109 3 mdtI Spermidine export protein MdtI Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A4WA58 1.95e-45 145 66 0 109 3 mdtI Spermidine export protein MdtI Enterobacter sp. (strain 638)
A6T8S6 5.24e-45 144 66 0 109 3 mdtI Spermidine export protein MdtI Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A8AGX4 7.2e-45 144 66 0 109 3 mdtI Spermidine export protein MdtI Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B5XR94 1.05e-44 143 66 0 109 3 mdtI Spermidine export protein MdtI Klebsiella pneumoniae (strain 342)
Q32G65 2.01e-42 137 65 0 107 3 mdtI Spermidine export protein MdtI Shigella dysenteriae serotype 1 (strain Sd197)
A8GFH6 1.98e-39 130 70 0 109 3 mdtI Spermidine export protein MdtI Serratia proteamaculans (strain 568)
Q8FHB5 2.18e-38 127 66 0 109 3 mdtI Spermidine export protein MdtI Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q2NVC1 2.3e-38 127 69 0 109 3 mdtI Spermidine export protein MdtI Sodalis glossinidius (strain morsitans)
Q3Z1V2 2.43e-38 127 66 0 109 3 mdtI Spermidine export protein MdtI Shigella sonnei (strain Ss046)
Q0T4H8 2.43e-38 127 66 0 109 3 mdtI Spermidine export protein MdtI Shigella flexneri serotype 5b (strain 8401)
Q320V5 2.43e-38 127 66 0 109 3 mdtI Spermidine export protein MdtI Shigella boydii serotype 4 (strain Sb227)
B2U1Q8 2.43e-38 127 66 0 109 3 mdtI Spermidine export protein MdtI Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q1RBJ9 2.43e-38 127 66 0 109 3 mdtI Spermidine export protein MdtI Escherichia coli (strain UTI89 / UPEC)
B1LET7 2.43e-38 127 66 0 109 3 mdtI Spermidine export protein MdtI Escherichia coli (strain SMS-3-5 / SECEC)
B6IB33 2.43e-38 127 66 0 109 3 mdtI Spermidine export protein MdtI Escherichia coli (strain SE11)
B7NB49 2.43e-38 127 66 0 109 3 mdtI Spermidine export protein MdtI Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P69210 2.43e-38 127 66 0 109 1 mdtI Spermidine export protein MdtI Escherichia coli (strain K12)
B1IQZ1 2.43e-38 127 66 0 109 3 mdtI Spermidine export protein MdtI Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A1ABE4 2.43e-38 127 66 0 109 3 mdtI Spermidine export protein MdtI Escherichia coli O1:K1 / APEC
A8A0E0 2.43e-38 127 66 0 109 3 mdtI Spermidine export protein MdtI Escherichia coli O9:H4 (strain HS)
B1XF64 2.43e-38 127 66 0 109 3 mdtI Spermidine export protein MdtI Escherichia coli (strain K12 / DH10B)
C4ZY62 2.43e-38 127 66 0 109 3 mdtI Spermidine export protein MdtI Escherichia coli (strain K12 / MC4100 / BW2952)
B7LZZ1 2.43e-38 127 66 0 109 3 mdtI Spermidine export protein MdtI Escherichia coli O8 (strain IAI1)
B7NUP0 2.43e-38 127 66 0 109 3 mdtI Spermidine export protein MdtI Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5Z435 2.43e-38 127 66 0 109 3 mdtI Spermidine export protein MdtI Escherichia coli O157:H7 (strain EC4115 / EHEC)
P69211 2.43e-38 127 66 0 109 3 mdtI Spermidine export protein MdtI Escherichia coli O157:H7
B7L5F1 2.43e-38 127 66 0 109 3 mdtI Spermidine export protein MdtI Escherichia coli (strain 55989 / EAEC)
B7M9V2 2.43e-38 127 66 0 109 3 mdtI Spermidine export protein MdtI Escherichia coli O45:K1 (strain S88 / ExPEC)
B7URT9 2.43e-38 127 66 0 109 3 mdtI Spermidine export protein MdtI Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZM58 2.43e-38 127 66 0 109 3 mdtI Spermidine export protein MdtI Escherichia coli O139:H28 (strain E24377A / ETEC)
Q83RD1 1.45e-37 125 65 0 109 3 mdtI Spermidine export protein MdtI Shigella flexneri
Q0THM9 1.08e-36 123 65 0 109 3 mdtI Spermidine export protein MdtI Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7MV45 1.08e-36 123 65 0 109 3 mdtI Spermidine export protein MdtI Escherichia coli O81 (strain ED1a)
A7MEJ5 5.41e-33 114 64 0 109 3 mdtI Spermidine export protein MdtI Cronobacter sakazakii (strain ATCC BAA-894)
P0CW82 1.84e-12 62 34 0 97 3 ebrB Multidrug resistance protein EbrB Bacillus subtilis (strain 168)
P0CW83 7.45e-12 60 34 2 98 1 ebrB Multidrug resistance protein EbrB Bacillus atrophaeus
P0CW81 9.23e-11 57 38 0 97 1 ebrA Multidrug resistance protein EbrA Bacillus atrophaeus
Q65JB1 9.53e-11 57 39 3 102 3 ebrA Multidrug resistance protein EbrA Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
P0AGD0 1.2e-10 57 35 0 97 3 qacE Quaternary ammonium compound-resistance protein QacE Klebsiella aerogenes
P0AGC9 1.2e-10 57 35 0 97 3 qacE Quaternary ammonium compound-resistance protein QacE Escherichia coli
Q73V87 8.39e-10 54 33 1 98 3 mmr Multidrug resistance protein mmr Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Q9X2N9 1.03e-09 54 35 2 100 3 qacF Quaternary ammonium compound-resistance protein QacF Klebsiella aerogenes
P23895 1.07e-09 54 32 0 93 1 emrE Multidrug transporter EmrE Escherichia coli (strain K12)
Q9CBP1 1.09e-09 54 33 1 100 3 mmr Multidrug resistance protein mmr Mycobacterium leprae (strain TN)
P0AA23 2e-09 53 35 0 90 3 ebr Putative ethidium bromide resistance protein Salmonella typhimurium
P0AA24 2e-09 53 35 0 90 3 ebr Putative ethidium bromide resistance protein Pseudomonas aeruginosa
P0AA22 2e-09 53 35 0 90 3 ebr Putative ethidium bromide resistance protein Escherichia coli
O32227 1.07e-08 52 31 0 94 3 yvaE Uncharacterized membrane protein YvaE Bacillus subtilis (strain 168)
O87866 1.48e-08 51 31 0 82 3 qacG Quaternary ammonium compound-resistance protein QacG Staphylococcus sp. (strain ST94)
O87868 4.37e-08 50 29 0 77 3 qacH Quaternary ammonium compound-resistance protein QacH Staphylococcus saprophyticus
Q8GAI5 5.25e-08 50 30 0 98 1 nepA Nicotine metabolites export pump subunit NepA Paenarthrobacter nicotinovorans
P9WGF1 5.25e-08 50 44 1 68 1 mmr Multidrug resistance protein Mmr Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGF0 5.25e-08 50 44 1 68 3 mmr Multidrug resistance protein Mmr Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P69927 5.25e-08 50 44 1 68 3 mmr Multidrug resistance protein mmr Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q65JB2 2.39e-07 48 27 0 97 3 ebrB Multidrug resistance protein EbrB Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
P14319 7.31e-07 47 25 0 94 1 qacC Quaternary ammonium compound-resistance protein QacC Staphylococcus aureus
P20928 7.67e-07 47 30 0 98 3 gdx Guanidinium exporter Proteus vulgaris
Q55339 1.71e-06 46 24 0 94 3 qacC Quaternary ammonium compound-resistance protein QacC Staphylococcus sp. (strain ST827)
P0CW80 1.89e-06 46 35 0 81 3 ebrA Multidrug resistance protein EbrA Bacillus subtilis (strain 168)
Q8FAL8 2.32e-06 45 27 0 99 3 gdx Guanidinium exporter Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P69938 2.34e-06 45 27 0 99 3 gdx Guanidinium exporter Shigella flexneri
P69937 2.34e-06 45 27 0 99 1 gdx Guanidinium exporter Escherichia coli (strain K12)
Q8XDQ5 2.34e-06 45 27 0 99 3 gdx Guanidinium exporter Escherichia coli O157:H7
A1JRE8 8.8e-06 44 31 0 97 3 mdtJ Spermidine export protein MdtJ Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q66FD1 1.4e-05 43 32 0 99 3 gdx Guanidinium exporter Yersinia pseudotuberculosis serotype I (strain IP32953)
Q8D1E4 1.4e-05 43 32 0 99 3 gdx Guanidinium exporter Yersinia pestis
Q7MZY0 2.69e-05 43 28 0 98 3 gdx Guanidinium exporter Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
O06999 0.000101 41 29 0 96 3 yvdR Uncharacterized membrane protein YvdR Bacillus subtilis (strain 168)
Q8GAI6 0.000122 42 32 3 101 1 nepB Nicotine metabolites export pump subunit NepB Paenarthrobacter nicotinovorans
Q2NVC0 0.000163 41 26 0 97 3 mdtJ Spermidine export protein MdtJ Sodalis glossinidius (strain morsitans)
Q6PT90 0.000251 40 32 0 76 3 gdx Guanidinium exporter Salmonella typhimurium
Q6PT86 0.000251 40 32 0 76 3 gdx Guanidinium exporter Salmonella thompson
Q79K00 0.000251 40 32 0 76 3 gdx Guanidinium exporter Salmonella choleraesuis (strain SC-B67)
Q799A3 0.000251 40 32 0 76 3 gdx Guanidinium exporter Klebsiella oxytoca
Q79IF2 0.000251 40 32 0 76 3 gdx Guanidinium exporter Escherichia coli
O69279 0.000251 40 32 0 76 1 gdx Guanidinium exporter Citrobacter freundii
A4TJJ0 0.000361 40 28 0 97 3 mdtJ Spermidine export protein MdtJ Yersinia pestis (strain Pestoides F)
Q1CJF5 0.000361 40 28 0 97 3 mdtJ Spermidine export protein MdtJ Yersinia pestis bv. Antiqua (strain Nepal516)
A9QYW2 0.000361 40 28 0 97 3 mdtJ Spermidine export protein MdtJ Yersinia pestis bv. Antiqua (strain Angola)
Q7CIC6 0.000361 40 28 0 97 3 mdtJ Spermidine export protein MdtJ Yersinia pestis
Q1C804 0.000361 40 28 0 97 3 mdtJ Spermidine export protein MdtJ Yersinia pestis bv. Antiqua (strain Antiqua)
Q9HUH5 0.000363 40 34 2 86 1 PA4990 Multidrug transporter PA4990 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
B1JLJ8 0.000396 40 28 0 97 3 mdtJ Spermidine export protein MdtJ Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A7FIB5 0.000396 40 28 0 97 3 mdtJ Spermidine export protein MdtJ Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A6T8S5 0.000511 40 34 3 100 3 mdtJ Spermidine export protein MdtJ Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q66AS9 0.000654 40 27 0 97 3 mdtJ Spermidine export protein MdtJ Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K336 0.000654 40 27 0 97 3 mdtJ Spermidine export protein MdtJ Yersinia pseudotuberculosis serotype IB (strain PB1/+)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_02120
Feature type CDS
Gene mdtI
Product multidrug/spermidine efflux SMR transporter subunit MdtI
Location 113523 - 113855 (strand: 1)
Length 333 (nucleotides) / 110 (amino acids)
In genomic island -

Contig

Accession contig_2
Length 292399 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_718
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00893 Small Multidrug Resistance protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2076 Defense mechanisms (V) V Multidrug transporter EmrE and related cation transporters

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K11742 spermidine export protein MdtI - -

Protein Sequence

MLSTFEWWHGAFLLLAVVLEILANILLKMSNGFKRLWLGILSLLAVLGAFSCLALAVRGIELSVAYALWGAFGIVATVAAGWILFNQRLNYKGWSGIILLLLGMVMIKFA

Flanking regions ( +/- flanking 50bp)

TGCCAAACCGGTTCGTGCGCCACTGAATGAGATGCTGAAAGGGGCGTAATATGTTATCGACATTTGAATGGTGGCACGGTGCATTTTTACTGCTGGCCGTGGTACTGGAGATTCTGGCGAATATCCTGCTGAAAATGTCAAACGGCTTTAAACGTCTGTGGCTGGGTATTTTATCGCTGCTGGCGGTATTGGGGGCGTTCAGTTGTCTGGCACTGGCAGTCCGCGGTATCGAGCTTTCCGTTGCGTATGCATTGTGGGGAGCATTCGGTATTGTGGCAACAGTGGCCGCAGGCTGGATCCTGTTTAACCAGCGCCTCAATTACAAAGGCTGGAGCGGGATTATTCTGCTTCTGCTGGGTATGGTGATGATTAAGTTTGCCTGATTGTCACCGGCAGTGAAGGATCAGCGTGCTGATCCTGTGTCATATCAGAA