Homologs in group_717

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_02585 EHELCC_02585 100.0 Morganella morganii S2 mdtJ multidrug/spermidine efflux SMR transporter subunit MdtJ
NLDBIP_00875 NLDBIP_00875 100.0 Morganella morganii S4 mdtJ multidrug/spermidine efflux SMR transporter subunit MdtJ
LHKJJB_01160 LHKJJB_01160 100.0 Morganella morganii S3 mdtJ multidrug/spermidine efflux SMR transporter subunit MdtJ
HKOGLL_01200 HKOGLL_01200 100.0 Morganella morganii S5 mdtJ multidrug/spermidine efflux SMR transporter subunit MdtJ
F4V73_RS04480 F4V73_RS04480 92.2 Morganella psychrotolerans mdtJ multidrug/spermidine efflux SMR transporter subunit MdtJ
PMI_RS05590 PMI_RS05590 74.4 Proteus mirabilis HI4320 mdtJ multidrug/spermidine efflux SMR transporter subunit MdtJ

Distribution of the homologs in the orthogroup group_717

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_717

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7N537 1.8e-54 170 77 0 114 3 mdtJ Spermidine export protein MdtJ Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B4EVU5 5.52e-54 169 75 0 119 3 mdtJ Spermidine export protein MdtJ Proteus mirabilis (strain HI4320)
A4TJJ0 1.55e-52 165 69 2 128 3 mdtJ Spermidine export protein MdtJ Yersinia pestis (strain Pestoides F)
Q1CJF5 1.55e-52 165 69 2 128 3 mdtJ Spermidine export protein MdtJ Yersinia pestis bv. Antiqua (strain Nepal516)
A9QYW2 1.55e-52 165 69 2 128 3 mdtJ Spermidine export protein MdtJ Yersinia pestis bv. Antiqua (strain Angola)
Q7CIC6 1.55e-52 165 69 2 128 3 mdtJ Spermidine export protein MdtJ Yersinia pestis
Q1C804 1.55e-52 165 69 2 128 3 mdtJ Spermidine export protein MdtJ Yersinia pestis bv. Antiqua (strain Antiqua)
B1JLJ8 5.01e-52 164 69 2 128 3 mdtJ Spermidine export protein MdtJ Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A7FIB5 5.01e-52 164 69 2 128 3 mdtJ Spermidine export protein MdtJ Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q66AS9 7.27e-52 163 68 2 128 3 mdtJ Spermidine export protein MdtJ Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K336 7.27e-52 163 68 2 128 3 mdtJ Spermidine export protein MdtJ Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A1JRE8 2.94e-51 161 69 0 116 3 mdtJ Spermidine export protein MdtJ Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A8GFH7 3.95e-48 153 70 0 111 3 mdtJ Spermidine export protein MdtJ Serratia proteamaculans (strain 568)
Q2NVC0 2.47e-47 151 70 0 109 3 mdtJ Spermidine export protein MdtJ Sodalis glossinidius (strain morsitans)
A4WA57 1e-43 142 62 1 116 3 mdtJ Spermidine export protein MdtJ Enterobacter sp. (strain 638)
B7URU0 5.05e-43 140 66 0 111 3 mdtJ Spermidine export protein MdtJ Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q3Z1V3 2.17e-42 139 65 0 111 3 mdtJ Spermidine export protein MdtJ Shigella sonnei (strain Ss046)
P69214 2.17e-42 139 65 0 111 3 mdtJ Spermidine export protein MdtJ Shigella flexneri
Q0T4H7 2.17e-42 139 65 0 111 3 mdtJ Spermidine export protein MdtJ Shigella flexneri serotype 5b (strain 8401)
Q32G66 2.17e-42 139 65 0 111 3 mdtJ Spermidine export protein MdtJ Shigella dysenteriae serotype 1 (strain Sd197)
Q320V6 2.17e-42 139 65 0 111 3 mdtJ Spermidine export protein MdtJ Shigella boydii serotype 4 (strain Sb227)
B2U1Q9 2.17e-42 139 65 0 111 3 mdtJ Spermidine export protein MdtJ Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q1RBJ8 2.17e-42 139 65 0 111 3 mdtJ Spermidine export protein MdtJ Escherichia coli (strain UTI89 / UPEC)
B1LET6 2.17e-42 139 65 0 111 3 mdtJ Spermidine export protein MdtJ Escherichia coli (strain SMS-3-5 / SECEC)
B6IB34 2.17e-42 139 65 0 111 3 mdtJ Spermidine export protein MdtJ Escherichia coli (strain SE11)
P69212 2.17e-42 139 65 0 111 1 mdtJ Spermidine export protein MdtJ Escherichia coli (strain K12)
B1IQZ0 2.17e-42 139 65 0 111 3 mdtJ Spermidine export protein MdtJ Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q0THM8 2.17e-42 139 65 0 111 3 mdtJ Spermidine export protein MdtJ Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1ABE5 2.17e-42 139 65 0 111 3 mdtJ Spermidine export protein MdtJ Escherichia coli O1:K1 / APEC
A8A0E1 2.17e-42 139 65 0 111 3 mdtJ Spermidine export protein MdtJ Escherichia coli O9:H4 (strain HS)
B1XF65 2.17e-42 139 65 0 111 3 mdtJ Spermidine export protein MdtJ Escherichia coli (strain K12 / DH10B)
C4ZY63 2.17e-42 139 65 0 111 3 mdtJ Spermidine export protein MdtJ Escherichia coli (strain K12 / MC4100 / BW2952)
B7LZZ2 2.17e-42 139 65 0 111 3 mdtJ Spermidine export protein MdtJ Escherichia coli O8 (strain IAI1)
B7MV46 2.17e-42 139 65 0 111 3 mdtJ Spermidine export protein MdtJ Escherichia coli O81 (strain ED1a)
B5Z436 2.17e-42 139 65 0 111 3 mdtJ Spermidine export protein MdtJ Escherichia coli O157:H7 (strain EC4115 / EHEC)
P69213 2.17e-42 139 65 0 111 3 mdtJ Spermidine export protein MdtJ Escherichia coli O157:H7
B7L5F2 2.17e-42 139 65 0 111 3 mdtJ Spermidine export protein MdtJ Escherichia coli (strain 55989 / EAEC)
B7M9V3 2.17e-42 139 65 0 111 3 mdtJ Spermidine export protein MdtJ Escherichia coli O45:K1 (strain S88 / ExPEC)
A7ZM59 2.17e-42 139 65 0 111 3 mdtJ Spermidine export protein MdtJ Escherichia coli O139:H28 (strain E24377A / ETEC)
Q8FHB4 3.11e-42 138 64 0 111 3 mdtJ Spermidine export protein MdtJ Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A6T8S5 1.54e-41 136 64 1 118 3 mdtJ Spermidine export protein MdtJ Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q7CQK1 2.66e-41 136 60 1 122 3 mdtJ Spermidine export protein MdtJ Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XEK5 2.66e-41 136 60 1 122 3 mdtJ Spermidine export protein MdtJ Salmonella typhi
C0Q4Y5 2.66e-41 136 60 1 122 3 mdtJ Spermidine export protein MdtJ Salmonella paratyphi C (strain RKS4594)
A9MZZ3 2.66e-41 136 60 1 122 3 mdtJ Spermidine export protein MdtJ Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4T5B8 2.66e-41 136 60 1 122 3 mdtJ Spermidine export protein MdtJ Salmonella newport (strain SL254)
B4THR3 2.66e-41 136 60 1 122 3 mdtJ Spermidine export protein MdtJ Salmonella heidelberg (strain SL476)
B5QUE4 2.66e-41 136 60 1 122 3 mdtJ Spermidine export protein MdtJ Salmonella enteritidis PT4 (strain P125109)
B5FHS2 2.66e-41 136 60 1 122 3 mdtJ Spermidine export protein MdtJ Salmonella dublin (strain CT_02021853)
Q57PF5 2.66e-41 136 60 1 122 3 mdtJ Spermidine export protein MdtJ Salmonella choleraesuis (strain SC-B67)
B5F6G4 3.31e-41 135 60 1 122 3 mdtJ Spermidine export protein MdtJ Salmonella agona (strain SL483)
B4TVE8 1.08e-40 134 60 1 122 3 mdtJ Spermidine export protein MdtJ Salmonella schwarzengrund (strain CVM19633)
B5BK90 1.08e-40 134 60 1 122 3 mdtJ Spermidine export protein MdtJ Salmonella paratyphi A (strain AKU_12601)
Q5PHJ7 1.08e-40 134 60 1 122 3 mdtJ Spermidine export protein MdtJ Salmonella paratyphi A (strain ATCC 9150 / SARB42)
A7MEJ4 1.04e-39 132 59 0 113 3 mdtJ Spermidine export protein MdtJ Cronobacter sakazakii (strain ATCC BAA-894)
A9MRT9 1.28e-39 131 59 1 122 3 mdtJ Spermidine export protein MdtJ Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A8AGX5 5.84e-39 130 63 0 107 3 mdtJ Spermidine export protein MdtJ Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
O32227 2.5e-13 64 33 1 113 3 yvaE Uncharacterized membrane protein YvaE Bacillus subtilis (strain 168)
P0AA23 1.83e-09 54 31 1 118 3 ebr Putative ethidium bromide resistance protein Salmonella typhimurium
P0AA24 1.83e-09 54 31 1 118 3 ebr Putative ethidium bromide resistance protein Pseudomonas aeruginosa
P0AA22 1.83e-09 54 31 1 118 3 ebr Putative ethidium bromide resistance protein Escherichia coli
P23895 5.29e-09 53 34 2 102 1 emrE Multidrug transporter EmrE Escherichia coli (strain K12)
P0CW82 9.08e-09 53 31 3 116 3 ebrB Multidrug resistance protein EbrB Bacillus subtilis (strain 168)
O06999 9.5e-09 52 33 0 95 3 yvdR Uncharacterized membrane protein YvdR Bacillus subtilis (strain 168)
P0AGD0 1.14e-08 52 31 0 103 3 qacE Quaternary ammonium compound-resistance protein QacE Klebsiella aerogenes
P0AGC9 1.14e-08 52 31 0 103 3 qacE Quaternary ammonium compound-resistance protein QacE Escherichia coli
Q8GAI6 6.12e-08 51 27 0 109 1 nepB Nicotine metabolites export pump subunit NepB Paenarthrobacter nicotinovorans
P0C7H7 9.13e-08 50 35 2 100 3 mdtI Spermidine export protein MdtI Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q7CQK0 1.63e-07 49 35 2 100 3 mdtI Spermidine export protein MdtI Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XG16 1.63e-07 49 35 2 100 3 mdtI Spermidine export protein MdtI Salmonella typhi
B4TVE9 1.63e-07 49 35 2 100 3 mdtI Spermidine export protein MdtI Salmonella schwarzengrund (strain CVM19633)
C0Q4Y4 1.63e-07 49 35 2 100 3 mdtI Spermidine export protein MdtI Salmonella paratyphi C (strain RKS4594)
A9MZZ2 1.63e-07 49 35 2 100 3 mdtI Spermidine export protein MdtI Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4T5B9 1.63e-07 49 35 2 100 3 mdtI Spermidine export protein MdtI Salmonella newport (strain SL254)
B4THR4 1.63e-07 49 35 2 100 3 mdtI Spermidine export protein MdtI Salmonella heidelberg (strain SL476)
B5QUE3 1.63e-07 49 35 2 100 3 mdtI Spermidine export protein MdtI Salmonella enteritidis PT4 (strain P125109)
B5FHS1 1.63e-07 49 35 2 100 3 mdtI Spermidine export protein MdtI Salmonella dublin (strain CT_02021853)
Q57PF4 1.63e-07 49 35 2 100 3 mdtI Spermidine export protein MdtI Salmonella choleraesuis (strain SC-B67)
B5F6G3 1.63e-07 49 35 2 100 3 mdtI Spermidine export protein MdtI Salmonella agona (strain SL483)
P0CW81 2.16e-07 49 28 0 103 1 ebrA Multidrug resistance protein EbrA Bacillus atrophaeus
P0CW83 4.31e-07 48 29 3 115 1 ebrB Multidrug resistance protein EbrB Bacillus atrophaeus
Q65JB2 7.58e-07 48 30 3 115 3 ebrB Multidrug resistance protein EbrB Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q9X2N9 1.7e-06 47 28 2 107 3 qacF Quaternary ammonium compound-resistance protein QacF Klebsiella aerogenes
B5XR94 2.39e-06 46 35 2 99 3 mdtI Spermidine export protein MdtI Klebsiella pneumoniae (strain 342)
A9MRT8 7.59e-06 45 34 2 99 3 mdtI Spermidine export protein MdtI Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q8FAL8 7.82e-06 45 33 2 104 3 gdx Guanidinium exporter Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A8GFH6 8.43e-06 45 35 2 99 3 mdtI Spermidine export protein MdtI Serratia proteamaculans (strain 568)
P69938 8.5e-06 45 33 2 104 3 gdx Guanidinium exporter Shigella flexneri
P69937 8.5e-06 45 33 2 104 1 gdx Guanidinium exporter Escherichia coli (strain K12)
Q8XDQ5 8.5e-06 45 33 2 104 3 gdx Guanidinium exporter Escherichia coli O157:H7
A6T8S6 9.77e-06 44 34 2 99 3 mdtI Spermidine export protein MdtI Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q65JB1 1.35e-05 44 24 0 99 3 ebrA Multidrug resistance protein EbrA Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q7N536 2.54e-05 43 32 2 99 3 mdtI Spermidine export protein MdtI Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q7CP98 2.9e-05 43 33 0 99 3 gdx Guanidinium exporter Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XGT8 2.9e-05 43 33 0 99 3 gdx Guanidinium exporter Salmonella typhi
Q32G65 4.15e-05 43 32 2 99 3 mdtI Spermidine export protein MdtI Shigella dysenteriae serotype 1 (strain Sd197)
Q66FD1 5.35e-05 42 32 0 99 3 gdx Guanidinium exporter Yersinia pseudotuberculosis serotype I (strain IP32953)
Q8D1E4 5.35e-05 42 32 0 99 3 gdx Guanidinium exporter Yersinia pestis
A4WA58 7.6e-05 42 33 2 99 3 mdtI Spermidine export protein MdtI Enterobacter sp. (strain 638)
Q6PT90 8.63e-05 42 32 2 104 3 gdx Guanidinium exporter Salmonella typhimurium
Q6PT86 8.63e-05 42 32 2 104 3 gdx Guanidinium exporter Salmonella thompson
Q79K00 8.63e-05 42 32 2 104 3 gdx Guanidinium exporter Salmonella choleraesuis (strain SC-B67)
Q799A3 8.63e-05 42 32 2 104 3 gdx Guanidinium exporter Klebsiella oxytoca
Q79IF2 8.63e-05 42 32 2 104 3 gdx Guanidinium exporter Escherichia coli
O69279 8.63e-05 42 32 2 104 1 gdx Guanidinium exporter Citrobacter freundii
Q9HUH5 9.63e-05 42 28 0 64 1 PA4990 Multidrug transporter PA4990 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q2NVC1 0.000138 42 32 2 99 3 mdtI Spermidine export protein MdtI Sodalis glossinidius (strain morsitans)
Q8FHB5 0.000156 41 33 2 99 3 mdtI Spermidine export protein MdtI Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P14319 0.000184 41 28 3 108 1 qacC Quaternary ammonium compound-resistance protein QacC Staphylococcus aureus
Q7MZY0 0.000224 41 33 0 99 3 gdx Guanidinium exporter Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
P0CW80 0.00023 41 28 0 84 3 ebrA Multidrug resistance protein EbrA Bacillus subtilis (strain 168)
Q3Z1V2 0.000249 41 32 2 99 3 mdtI Spermidine export protein MdtI Shigella sonnei (strain Ss046)
Q0T4H8 0.000249 41 32 2 99 3 mdtI Spermidine export protein MdtI Shigella flexneri serotype 5b (strain 8401)
Q320V5 0.000249 41 32 2 99 3 mdtI Spermidine export protein MdtI Shigella boydii serotype 4 (strain Sb227)
B2U1Q8 0.000249 41 32 2 99 3 mdtI Spermidine export protein MdtI Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q1RBJ9 0.000249 41 32 2 99 3 mdtI Spermidine export protein MdtI Escherichia coli (strain UTI89 / UPEC)
B1LET7 0.000249 41 32 2 99 3 mdtI Spermidine export protein MdtI Escherichia coli (strain SMS-3-5 / SECEC)
B6IB33 0.000249 41 32 2 99 3 mdtI Spermidine export protein MdtI Escherichia coli (strain SE11)
B7NB49 0.000249 41 32 2 99 3 mdtI Spermidine export protein MdtI Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P69210 0.000249 41 32 2 99 1 mdtI Spermidine export protein MdtI Escherichia coli (strain K12)
B1IQZ1 0.000249 41 32 2 99 3 mdtI Spermidine export protein MdtI Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A1ABE4 0.000249 41 32 2 99 3 mdtI Spermidine export protein MdtI Escherichia coli O1:K1 / APEC
A8A0E0 0.000249 41 32 2 99 3 mdtI Spermidine export protein MdtI Escherichia coli O9:H4 (strain HS)
B1XF64 0.000249 41 32 2 99 3 mdtI Spermidine export protein MdtI Escherichia coli (strain K12 / DH10B)
C4ZY62 0.000249 41 32 2 99 3 mdtI Spermidine export protein MdtI Escherichia coli (strain K12 / MC4100 / BW2952)
B7LZZ1 0.000249 41 32 2 99 3 mdtI Spermidine export protein MdtI Escherichia coli O8 (strain IAI1)
B7NUP0 0.000249 41 32 2 99 3 mdtI Spermidine export protein MdtI Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5Z435 0.000249 41 32 2 99 3 mdtI Spermidine export protein MdtI Escherichia coli O157:H7 (strain EC4115 / EHEC)
P69211 0.000249 41 32 2 99 3 mdtI Spermidine export protein MdtI Escherichia coli O157:H7
B7L5F1 0.000249 41 32 2 99 3 mdtI Spermidine export protein MdtI Escherichia coli (strain 55989 / EAEC)
B7M9V2 0.000249 41 32 2 99 3 mdtI Spermidine export protein MdtI Escherichia coli O45:K1 (strain S88 / ExPEC)
B7URT9 0.000249 41 32 2 99 3 mdtI Spermidine export protein MdtI Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZM58 0.000249 41 32 2 99 3 mdtI Spermidine export protein MdtI Escherichia coli O139:H28 (strain E24377A / ETEC)
A1JRE5 0.000276 40 34 0 97 3 mdtI Spermidine export protein MdtI Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B1JLJ7 0.000398 40 31 0 97 3 mdtI Spermidine export protein MdtI Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A4TJI9 0.000398 40 31 0 97 3 mdtI Spermidine export protein MdtI Yersinia pestis (strain Pestoides F)
Q1CJF4 0.000398 40 31 0 97 3 mdtI Spermidine export protein MdtI Yersinia pestis bv. Antiqua (strain Nepal516)
A9QYW1 0.000398 40 31 0 97 3 mdtI Spermidine export protein MdtI Yersinia pestis bv. Antiqua (strain Angola)
Q0WF87 0.000398 40 31 0 97 3 mdtI Spermidine export protein MdtI Yersinia pestis
Q1C803 0.000398 40 31 0 97 3 mdtI Spermidine export protein MdtI Yersinia pestis bv. Antiqua (strain Antiqua)
A7FIB4 0.000398 40 31 0 97 3 mdtI Spermidine export protein MdtI Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q0THM9 0.000402 40 32 2 99 3 mdtI Spermidine export protein MdtI Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7MV45 0.000402 40 32 2 99 3 mdtI Spermidine export protein MdtI Escherichia coli O81 (strain ED1a)
A8AGX4 0.000515 40 31 2 99 3 mdtI Spermidine export protein MdtI Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q55339 0.000536 40 27 3 108 3 qacC Quaternary ammonium compound-resistance protein QacC Staphylococcus sp. (strain ST827)
Q66AS8 0.000822 39 30 0 97 3 mdtI Spermidine export protein MdtI Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K337 0.000822 39 30 0 97 3 mdtI Spermidine export protein MdtI Yersinia pseudotuberculosis serotype IB (strain PB1/+)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_02115
Feature type CDS
Gene mdtJ
Product multidrug/spermidine efflux SMR transporter subunit MdtJ
Location 113132 - 113521 (strand: 1)
Length 390 (nucleotides) / 129 (amino acids)
In genomic island -

Contig

Accession contig_2
Length 292399 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_717
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00893 Small Multidrug Resistance protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2076 Defense mechanisms (V) V Multidrug transporter EmrE and related cation transporters

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K11743 spermidine export protein MdtJ - -

Protein Sequence

MIYWMFLGLAIITEVIGTLSMKYASVSGDSAGMIVMYIMIASSYILLSMAVKKVALGVAYALWEGIGILIITTFSVMWFHESLSPLKLGGLALLIAGITLIKYGTKKVQKKQPAAKPVRAPLNEMLKGA

Flanking regions ( +/- flanking 50bp)

TCTGTTTTGCGCCATGAACCTGTATGCGTTGTCCATCAGGAGAAATAACTATGATTTACTGGATGTTTTTAGGCTTAGCCATTATTACCGAGGTGATCGGTACATTGTCGATGAAATACGCGAGTGTCTCCGGTGACAGTGCGGGGATGATTGTGATGTATATCATGATTGCCTCTTCTTATATTTTATTATCCATGGCAGTGAAAAAAGTGGCCCTCGGGGTGGCTTATGCGCTGTGGGAAGGGATCGGGATCCTGATCATCACCACGTTCAGTGTGATGTGGTTCCATGAATCGCTGTCACCGCTGAAACTGGGCGGTCTGGCACTGTTAATCGCGGGTATCACCCTGATTAAATACGGCACCAAAAAAGTGCAGAAAAAGCAGCCTGCTGCCAAACCGGTTCGTGCGCCACTGAATGAGATGCTGAAAGGGGCGTAATATGTTATCGACATTTGAATGGTGGCACGGTGCATTTTTACTGCTGGCCG