Homologs in group_717

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_02115 FBDBKF_02115 92.2 Morganella morganii S1 mdtJ multidrug/spermidine efflux SMR transporter subunit MdtJ
EHELCC_02585 EHELCC_02585 92.2 Morganella morganii S2 mdtJ multidrug/spermidine efflux SMR transporter subunit MdtJ
NLDBIP_00875 NLDBIP_00875 92.2 Morganella morganii S4 mdtJ multidrug/spermidine efflux SMR transporter subunit MdtJ
LHKJJB_01160 LHKJJB_01160 92.2 Morganella morganii S3 mdtJ multidrug/spermidine efflux SMR transporter subunit MdtJ
HKOGLL_01200 HKOGLL_01200 92.2 Morganella morganii S5 mdtJ multidrug/spermidine efflux SMR transporter subunit MdtJ
PMI_RS05590 PMI_RS05590 71.5 Proteus mirabilis HI4320 mdtJ multidrug/spermidine efflux SMR transporter subunit MdtJ

Distribution of the homologs in the orthogroup group_717

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_717

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7N537 8.18e-56 173 78 0 114 3 mdtJ Spermidine export protein MdtJ Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B4EVU5 5.26e-54 169 77 0 114 3 mdtJ Spermidine export protein MdtJ Proteus mirabilis (strain HI4320)
Q66AS9 3.79e-52 164 68 1 122 3 mdtJ Spermidine export protein MdtJ Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K336 3.79e-52 164 68 1 122 3 mdtJ Spermidine export protein MdtJ Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A4TJJ0 4.77e-52 164 68 1 122 3 mdtJ Spermidine export protein MdtJ Yersinia pestis (strain Pestoides F)
Q1CJF5 4.77e-52 164 68 1 122 3 mdtJ Spermidine export protein MdtJ Yersinia pestis bv. Antiqua (strain Nepal516)
A9QYW2 4.77e-52 164 68 1 122 3 mdtJ Spermidine export protein MdtJ Yersinia pestis bv. Antiqua (strain Angola)
Q7CIC6 4.77e-52 164 68 1 122 3 mdtJ Spermidine export protein MdtJ Yersinia pestis
Q1C804 4.77e-52 164 68 1 122 3 mdtJ Spermidine export protein MdtJ Yersinia pestis bv. Antiqua (strain Antiqua)
A1JRE8 5.92e-52 163 70 0 114 3 mdtJ Spermidine export protein MdtJ Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B1JLJ8 7.99e-52 163 68 1 122 3 mdtJ Spermidine export protein MdtJ Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A7FIB5 7.99e-52 163 68 1 122 3 mdtJ Spermidine export protein MdtJ Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A8GFH7 9.07e-49 155 67 0 114 3 mdtJ Spermidine export protein MdtJ Serratia proteamaculans (strain 568)
Q2NVC0 3.66e-48 153 71 0 108 3 mdtJ Spermidine export protein MdtJ Sodalis glossinidius (strain morsitans)
A4WA57 2.6e-44 143 64 1 114 3 mdtJ Spermidine export protein MdtJ Enterobacter sp. (strain 638)
A6T8S5 3.22e-43 140 61 0 119 3 mdtJ Spermidine export protein MdtJ Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q3Z1V3 4.97e-43 140 64 0 114 3 mdtJ Spermidine export protein MdtJ Shigella sonnei (strain Ss046)
P69214 4.97e-43 140 64 0 114 3 mdtJ Spermidine export protein MdtJ Shigella flexneri
Q0T4H7 4.97e-43 140 64 0 114 3 mdtJ Spermidine export protein MdtJ Shigella flexneri serotype 5b (strain 8401)
Q32G66 4.97e-43 140 64 0 114 3 mdtJ Spermidine export protein MdtJ Shigella dysenteriae serotype 1 (strain Sd197)
Q320V6 4.97e-43 140 64 0 114 3 mdtJ Spermidine export protein MdtJ Shigella boydii serotype 4 (strain Sb227)
B2U1Q9 4.97e-43 140 64 0 114 3 mdtJ Spermidine export protein MdtJ Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q1RBJ8 4.97e-43 140 64 0 114 3 mdtJ Spermidine export protein MdtJ Escherichia coli (strain UTI89 / UPEC)
B1LET6 4.97e-43 140 64 0 114 3 mdtJ Spermidine export protein MdtJ Escherichia coli (strain SMS-3-5 / SECEC)
B6IB34 4.97e-43 140 64 0 114 3 mdtJ Spermidine export protein MdtJ Escherichia coli (strain SE11)
P69212 4.97e-43 140 64 0 114 1 mdtJ Spermidine export protein MdtJ Escherichia coli (strain K12)
B1IQZ0 4.97e-43 140 64 0 114 3 mdtJ Spermidine export protein MdtJ Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q0THM8 4.97e-43 140 64 0 114 3 mdtJ Spermidine export protein MdtJ Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1ABE5 4.97e-43 140 64 0 114 3 mdtJ Spermidine export protein MdtJ Escherichia coli O1:K1 / APEC
A8A0E1 4.97e-43 140 64 0 114 3 mdtJ Spermidine export protein MdtJ Escherichia coli O9:H4 (strain HS)
B1XF65 4.97e-43 140 64 0 114 3 mdtJ Spermidine export protein MdtJ Escherichia coli (strain K12 / DH10B)
C4ZY63 4.97e-43 140 64 0 114 3 mdtJ Spermidine export protein MdtJ Escherichia coli (strain K12 / MC4100 / BW2952)
B7LZZ2 4.97e-43 140 64 0 114 3 mdtJ Spermidine export protein MdtJ Escherichia coli O8 (strain IAI1)
B7MV46 4.97e-43 140 64 0 114 3 mdtJ Spermidine export protein MdtJ Escherichia coli O81 (strain ED1a)
B5Z436 4.97e-43 140 64 0 114 3 mdtJ Spermidine export protein MdtJ Escherichia coli O157:H7 (strain EC4115 / EHEC)
P69213 4.97e-43 140 64 0 114 3 mdtJ Spermidine export protein MdtJ Escherichia coli O157:H7
B7L5F2 4.97e-43 140 64 0 114 3 mdtJ Spermidine export protein MdtJ Escherichia coli (strain 55989 / EAEC)
B7M9V3 4.97e-43 140 64 0 114 3 mdtJ Spermidine export protein MdtJ Escherichia coli O45:K1 (strain S88 / ExPEC)
A7ZM59 4.97e-43 140 64 0 114 3 mdtJ Spermidine export protein MdtJ Escherichia coli O139:H28 (strain E24377A / ETEC)
Q8FHB4 8.14e-43 140 64 0 114 3 mdtJ Spermidine export protein MdtJ Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B7URU0 2.62e-42 138 64 0 114 3 mdtJ Spermidine export protein MdtJ Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q7CQK1 2.42e-41 136 59 1 123 3 mdtJ Spermidine export protein MdtJ Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XEK5 2.42e-41 136 59 1 123 3 mdtJ Spermidine export protein MdtJ Salmonella typhi
C0Q4Y5 2.42e-41 136 59 1 123 3 mdtJ Spermidine export protein MdtJ Salmonella paratyphi C (strain RKS4594)
A9MZZ3 2.42e-41 136 59 1 123 3 mdtJ Spermidine export protein MdtJ Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4T5B8 2.42e-41 136 59 1 123 3 mdtJ Spermidine export protein MdtJ Salmonella newport (strain SL254)
B4THR3 2.42e-41 136 59 1 123 3 mdtJ Spermidine export protein MdtJ Salmonella heidelberg (strain SL476)
B5QUE4 2.42e-41 136 59 1 123 3 mdtJ Spermidine export protein MdtJ Salmonella enteritidis PT4 (strain P125109)
B5FHS2 2.42e-41 136 59 1 123 3 mdtJ Spermidine export protein MdtJ Salmonella dublin (strain CT_02021853)
Q57PF5 2.42e-41 136 59 1 123 3 mdtJ Spermidine export protein MdtJ Salmonella choleraesuis (strain SC-B67)
B5F6G4 2.59e-41 136 59 0 119 3 mdtJ Spermidine export protein MdtJ Salmonella agona (strain SL483)
B4TVE8 4.33e-41 135 59 0 119 3 mdtJ Spermidine export protein MdtJ Salmonella schwarzengrund (strain CVM19633)
B5BK90 4.33e-41 135 59 0 119 3 mdtJ Spermidine export protein MdtJ Salmonella paratyphi A (strain AKU_12601)
Q5PHJ7 4.33e-41 135 59 0 119 3 mdtJ Spermidine export protein MdtJ Salmonella paratyphi A (strain ATCC 9150 / SARB42)
A8AGX5 1.2e-40 134 57 0 119 3 mdtJ Spermidine export protein MdtJ Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A9MRT9 1.48e-39 131 59 1 123 3 mdtJ Spermidine export protein MdtJ Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A7MEJ4 3.05e-39 130 58 0 113 3 mdtJ Spermidine export protein MdtJ Cronobacter sakazakii (strain ATCC BAA-894)
O32227 2.12e-15 70 35 1 114 3 yvaE Uncharacterized membrane protein YvaE Bacillus subtilis (strain 168)
P0AA23 1.44e-11 60 32 0 111 3 ebr Putative ethidium bromide resistance protein Salmonella typhimurium
P0AA24 1.44e-11 60 32 0 111 3 ebr Putative ethidium bromide resistance protein Pseudomonas aeruginosa
P0AA22 1.44e-11 60 32 0 111 3 ebr Putative ethidium bromide resistance protein Escherichia coli
P0AGD0 8.61e-10 55 30 0 107 3 qacE Quaternary ammonium compound-resistance protein QacE Klebsiella aerogenes
P0AGC9 8.61e-10 55 30 0 107 3 qacE Quaternary ammonium compound-resistance protein QacE Escherichia coli
P0CW82 1.38e-09 55 31 3 118 3 ebrB Multidrug resistance protein EbrB Bacillus subtilis (strain 168)
P0CW83 5.32e-09 53 30 2 120 1 ebrB Multidrug resistance protein EbrB Bacillus atrophaeus
P23895 7.33e-09 53 33 2 102 1 emrE Multidrug transporter EmrE Escherichia coli (strain K12)
Q65JB2 1.04e-08 52 34 3 113 3 ebrB Multidrug resistance protein EbrB Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
O06999 1.16e-08 52 31 0 95 3 yvdR Uncharacterized membrane protein YvdR Bacillus subtilis (strain 168)
P0CW81 1.89e-08 52 28 0 103 1 ebrA Multidrug resistance protein EbrA Bacillus atrophaeus
Q8GAI6 2.18e-08 53 27 2 113 1 nepB Nicotine metabolites export pump subunit NepB Paenarthrobacter nicotinovorans
P0C7H7 2.77e-08 51 35 2 104 3 mdtI Spermidine export protein MdtI Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q7CQK0 1.13e-07 50 34 2 104 3 mdtI Spermidine export protein MdtI Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XG16 1.13e-07 50 34 2 104 3 mdtI Spermidine export protein MdtI Salmonella typhi
B4TVE9 1.13e-07 50 34 2 104 3 mdtI Spermidine export protein MdtI Salmonella schwarzengrund (strain CVM19633)
C0Q4Y4 1.13e-07 50 34 2 104 3 mdtI Spermidine export protein MdtI Salmonella paratyphi C (strain RKS4594)
A9MZZ2 1.13e-07 50 34 2 104 3 mdtI Spermidine export protein MdtI Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4T5B9 1.13e-07 50 34 2 104 3 mdtI Spermidine export protein MdtI Salmonella newport (strain SL254)
B4THR4 1.13e-07 50 34 2 104 3 mdtI Spermidine export protein MdtI Salmonella heidelberg (strain SL476)
B5QUE3 1.13e-07 50 34 2 104 3 mdtI Spermidine export protein MdtI Salmonella enteritidis PT4 (strain P125109)
B5FHS1 1.13e-07 50 34 2 104 3 mdtI Spermidine export protein MdtI Salmonella dublin (strain CT_02021853)
Q57PF4 1.13e-07 50 34 2 104 3 mdtI Spermidine export protein MdtI Salmonella choleraesuis (strain SC-B67)
B5F6G3 1.13e-07 50 34 2 104 3 mdtI Spermidine export protein MdtI Salmonella agona (strain SL483)
Q9X2N9 3.36e-07 48 26 0 107 3 qacF Quaternary ammonium compound-resistance protein QacF Klebsiella aerogenes
Q8FAL8 9.83e-07 47 32 0 103 3 gdx Guanidinium exporter Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q65JB1 1.02e-06 47 26 0 99 3 ebrA Multidrug resistance protein EbrA Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
P69938 1.07e-06 47 32 0 103 3 gdx Guanidinium exporter Shigella flexneri
P69937 1.07e-06 47 32 0 103 1 gdx Guanidinium exporter Escherichia coli (strain K12)
Q8XDQ5 1.07e-06 47 32 0 103 3 gdx Guanidinium exporter Escherichia coli O157:H7
A8GFH6 1.54e-06 47 36 2 99 3 mdtI Spermidine export protein MdtI Serratia proteamaculans (strain 568)
B5XR94 1.77e-06 47 35 2 99 3 mdtI Spermidine export protein MdtI Klebsiella pneumoniae (strain 342)
A9MRT8 6.71e-06 45 33 2 99 3 mdtI Spermidine export protein MdtI Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A6T8S6 7.22e-06 45 34 2 99 3 mdtI Spermidine export protein MdtI Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q32G65 1.05e-05 44 34 2 99 3 mdtI Spermidine export protein MdtI Shigella dysenteriae serotype 1 (strain Sd197)
Q7CP98 1.53e-05 44 32 0 99 3 gdx Guanidinium exporter Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XGT8 1.53e-05 44 32 0 99 3 gdx Guanidinium exporter Salmonella typhi
Q66FD1 1.59e-05 44 32 0 99 3 gdx Guanidinium exporter Yersinia pseudotuberculosis serotype I (strain IP32953)
Q8D1E4 1.59e-05 44 32 0 99 3 gdx Guanidinium exporter Yersinia pestis
Q7N536 1.94e-05 43 32 2 99 3 mdtI Spermidine export protein MdtI Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
P0CW80 3.03e-05 43 28 0 84 3 ebrA Multidrug resistance protein EbrA Bacillus subtilis (strain 168)
Q6PT90 3.4e-05 43 32 2 104 3 gdx Guanidinium exporter Salmonella typhimurium
Q6PT86 3.4e-05 43 32 2 104 3 gdx Guanidinium exporter Salmonella thompson
Q79K00 3.4e-05 43 32 2 104 3 gdx Guanidinium exporter Salmonella choleraesuis (strain SC-B67)
Q799A3 3.4e-05 43 32 2 104 3 gdx Guanidinium exporter Klebsiella oxytoca
Q79IF2 3.4e-05 43 32 2 104 3 gdx Guanidinium exporter Escherichia coli
O69279 3.4e-05 43 32 2 104 1 gdx Guanidinium exporter Citrobacter freundii
A4WA58 3.9e-05 43 36 4 100 3 mdtI Spermidine export protein MdtI Enterobacter sp. (strain 638)
Q9HUH5 5.16e-05 43 27 0 66 1 PA4990 Multidrug transporter PA4990 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8FHB5 5.92e-05 42 35 2 99 3 mdtI Spermidine export protein MdtI Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P14319 6.9e-05 42 26 1 105 1 qacC Quaternary ammonium compound-resistance protein QacC Staphylococcus aureus
Q2NVC1 7e-05 42 33 2 99 3 mdtI Spermidine export protein MdtI Sodalis glossinidius (strain morsitans)
Q3Z1V2 9.47e-05 42 34 2 99 3 mdtI Spermidine export protein MdtI Shigella sonnei (strain Ss046)
Q0T4H8 9.47e-05 42 34 2 99 3 mdtI Spermidine export protein MdtI Shigella flexneri serotype 5b (strain 8401)
Q320V5 9.47e-05 42 34 2 99 3 mdtI Spermidine export protein MdtI Shigella boydii serotype 4 (strain Sb227)
B2U1Q8 9.47e-05 42 34 2 99 3 mdtI Spermidine export protein MdtI Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q1RBJ9 9.47e-05 42 34 2 99 3 mdtI Spermidine export protein MdtI Escherichia coli (strain UTI89 / UPEC)
B1LET7 9.47e-05 42 34 2 99 3 mdtI Spermidine export protein MdtI Escherichia coli (strain SMS-3-5 / SECEC)
B6IB33 9.47e-05 42 34 2 99 3 mdtI Spermidine export protein MdtI Escherichia coli (strain SE11)
B7NB49 9.47e-05 42 34 2 99 3 mdtI Spermidine export protein MdtI Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P69210 9.47e-05 42 34 2 99 1 mdtI Spermidine export protein MdtI Escherichia coli (strain K12)
B1IQZ1 9.47e-05 42 34 2 99 3 mdtI Spermidine export protein MdtI Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A1ABE4 9.47e-05 42 34 2 99 3 mdtI Spermidine export protein MdtI Escherichia coli O1:K1 / APEC
A8A0E0 9.47e-05 42 34 2 99 3 mdtI Spermidine export protein MdtI Escherichia coli O9:H4 (strain HS)
B1XF64 9.47e-05 42 34 2 99 3 mdtI Spermidine export protein MdtI Escherichia coli (strain K12 / DH10B)
C4ZY62 9.47e-05 42 34 2 99 3 mdtI Spermidine export protein MdtI Escherichia coli (strain K12 / MC4100 / BW2952)
B7LZZ1 9.47e-05 42 34 2 99 3 mdtI Spermidine export protein MdtI Escherichia coli O8 (strain IAI1)
B7NUP0 9.47e-05 42 34 2 99 3 mdtI Spermidine export protein MdtI Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5Z435 9.47e-05 42 34 2 99 3 mdtI Spermidine export protein MdtI Escherichia coli O157:H7 (strain EC4115 / EHEC)
P69211 9.47e-05 42 34 2 99 3 mdtI Spermidine export protein MdtI Escherichia coli O157:H7
B7L5F1 9.47e-05 42 34 2 99 3 mdtI Spermidine export protein MdtI Escherichia coli (strain 55989 / EAEC)
B7M9V2 9.47e-05 42 34 2 99 3 mdtI Spermidine export protein MdtI Escherichia coli O45:K1 (strain S88 / ExPEC)
B7URT9 9.47e-05 42 34 2 99 3 mdtI Spermidine export protein MdtI Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZM58 9.47e-05 42 34 2 99 3 mdtI Spermidine export protein MdtI Escherichia coli O139:H28 (strain E24377A / ETEC)
Q7MZY0 0.000117 42 33 0 99 3 gdx Guanidinium exporter Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q55339 0.00018 41 25 1 105 3 qacC Quaternary ammonium compound-resistance protein QacC Staphylococcus sp. (strain ST827)
A8AGX4 0.000186 41 32 2 99 3 mdtI Spermidine export protein MdtI Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q0THM9 0.000194 41 34 2 99 3 mdtI Spermidine export protein MdtI Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7MV45 0.000194 41 34 2 99 3 mdtI Spermidine export protein MdtI Escherichia coli O81 (strain ED1a)
O87868 0.000219 41 29 0 78 3 qacH Quaternary ammonium compound-resistance protein QacH Staphylococcus saprophyticus
Q73V87 0.00029 40 33 3 98 3 mmr Multidrug resistance protein mmr Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A1JRE5 0.000337 40 31 0 97 3 mdtI Spermidine export protein MdtI Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q9CBP1 0.000361 40 31 3 98 3 mmr Multidrug resistance protein mmr Mycobacterium leprae (strain TN)
O87866 0.000377 40 26 0 82 3 qacG Quaternary ammonium compound-resistance protein QacG Staphylococcus sp. (strain ST94)
Q83RD1 0.00051 40 33 2 99 3 mdtI Spermidine export protein MdtI Shigella flexneri
Q8GAI5 0.000554 40 29 0 95 1 nepA Nicotine metabolites export pump subunit NepA Paenarthrobacter nicotinovorans
B1JLJ7 0.000848 39 30 0 97 3 mdtI Spermidine export protein MdtI Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A4TJI9 0.000848 39 30 0 97 3 mdtI Spermidine export protein MdtI Yersinia pestis (strain Pestoides F)
Q1CJF4 0.000848 39 30 0 97 3 mdtI Spermidine export protein MdtI Yersinia pestis bv. Antiqua (strain Nepal516)
A9QYW1 0.000848 39 30 0 97 3 mdtI Spermidine export protein MdtI Yersinia pestis bv. Antiqua (strain Angola)
Q0WF87 0.000848 39 30 0 97 3 mdtI Spermidine export protein MdtI Yersinia pestis
Q1C803 0.000848 39 30 0 97 3 mdtI Spermidine export protein MdtI Yersinia pestis bv. Antiqua (strain Antiqua)
A7FIB4 0.000848 39 30 0 97 3 mdtI Spermidine export protein MdtI Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS04480
Feature type CDS
Gene mdtJ
Product multidrug/spermidine efflux SMR transporter subunit MdtJ
Location 949344 - 949736 (strand: 1)
Length 393 (nucleotides) / 130 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_717
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00893 Small Multidrug Resistance protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2076 Defense mechanisms (V) V Multidrug transporter EmrE and related cation transporters

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K11743 spermidine export protein MdtJ - -

Protein Sequence

MIYWMFLGLAIVTEVIGTLSMKYASVSGDTAGMVVMYIMIAASYILLSMAVKKVALGVAYALWEGIGILIITTFSVMWFQESLSPMKLGGLALLIAGITLIKYGTKKAVQKKQPVAKPSYAPLNEMMKGA

Flanking regions ( +/- flanking 50bp)

TTTATGGTGTGTCGTGAACCTGTATGCGTTGTACATCAGGAAAAATAACTATGATTTACTGGATGTTTTTAGGCTTAGCCATTGTGACTGAGGTCATCGGAACATTGTCGATGAAATACGCAAGTGTTTCAGGCGACACCGCAGGAATGGTTGTGATGTATATCATGATCGCTGCATCTTATATCTTACTGTCCATGGCGGTTAAAAAAGTGGCTCTCGGCGTGGCATATGCGCTGTGGGAAGGAATTGGGATCCTCATCATTACCACATTCAGTGTGATGTGGTTCCAGGAATCACTTTCGCCAATGAAACTGGGCGGTCTGGCGCTGTTAATTGCAGGGATAACCCTGATTAAGTACGGTACCAAAAAAGCAGTACAGAAAAAACAGCCTGTTGCAAAACCGTCTTATGCGCCACTGAACGAGATGATGAAAGGGGCGTAATATGTTGTCGACATTTGAATGGTGGCACGGGGCATTTTTACTGCTGGCTG