Homologs in group_609

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_02385 EHELCC_02385 100.0 Morganella morganii S2 lolB lipoprotein insertase outer membrane protein LolB
NLDBIP_01075 NLDBIP_01075 100.0 Morganella morganii S4 lolB lipoprotein insertase outer membrane protein LolB
LHKJJB_00960 LHKJJB_00960 100.0 Morganella morganii S3 lolB lipoprotein insertase outer membrane protein LolB
HKOGLL_01000 HKOGLL_01000 100.0 Morganella morganii S5 lolB lipoprotein insertase outer membrane protein LolB
F4V73_RS04260 F4V73_RS04260 86.6 Morganella psychrotolerans lolB lipoprotein insertase outer membrane protein LolB
PMI_RS05255 PMI_RS05255 49.8 Proteus mirabilis HI4320 lolB lipoprotein insertase outer membrane protein LolB

Distribution of the homologs in the orthogroup group_609

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_609

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A8GDA1 4.73e-81 243 56 1 200 3 lolB Outer-membrane lipoprotein LolB Serratia proteamaculans (strain 568)
A9MP99 2.2e-75 228 53 1 201 3 lolB Outer-membrane lipoprotein LolB Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q8Z6A0 9.11e-75 227 53 1 201 3 lolB Outer-membrane lipoprotein LolB Salmonella typhi
P30752 9.42e-75 227 53 1 201 3 lolB Outer-membrane lipoprotein LolB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B5BI73 9.42e-75 227 53 1 201 3 lolB Outer-membrane lipoprotein LolB Salmonella paratyphi A (strain AKU_12601)
C0Q358 9.42e-75 227 53 1 201 3 lolB Outer-membrane lipoprotein LolB Salmonella paratyphi C (strain RKS4594)
A9MW01 9.42e-75 227 53 1 201 3 lolB Outer-membrane lipoprotein LolB Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PCR1 9.42e-75 227 53 1 201 3 lolB Outer-membrane lipoprotein LolB Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SUG5 9.42e-75 227 53 1 201 3 lolB Outer-membrane lipoprotein LolB Salmonella newport (strain SL254)
B4TKA7 9.42e-75 227 53 1 201 3 lolB Outer-membrane lipoprotein LolB Salmonella heidelberg (strain SL476)
B5R922 9.42e-75 227 53 1 201 3 lolB Outer-membrane lipoprotein LolB Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R3J7 9.42e-75 227 53 1 201 3 lolB Outer-membrane lipoprotein LolB Salmonella enteritidis PT4 (strain P125109)
B5FU16 9.42e-75 227 53 1 201 3 lolB Outer-membrane lipoprotein LolB Salmonella dublin (strain CT_02021853)
Q57NN3 9.42e-75 227 53 1 201 3 lolB Outer-membrane lipoprotein LolB Salmonella choleraesuis (strain SC-B67)
B5F4H3 9.42e-75 227 53 1 201 3 lolB Outer-membrane lipoprotein LolB Salmonella agona (strain SL483)
B4TXU5 9.73e-75 227 53 1 201 3 lolB Outer-membrane lipoprotein LolB Salmonella schwarzengrund (strain CVM19633)
A8AG00 5.19e-73 223 52 2 202 3 lolB Outer-membrane lipoprotein LolB Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q8CW45 6.18e-73 222 52 2 202 3 lolB Outer-membrane lipoprotein LolB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TIG1 7.77e-73 222 52 2 202 3 lolB Outer-membrane lipoprotein LolB Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7LSI1 1.36e-72 221 52 1 201 3 lolB Outer-membrane lipoprotein LolB Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
A7FIG3 1.48e-72 221 57 2 201 3 lolB Outer-membrane lipoprotein LolB Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A4TJN9 1.56e-72 221 56 2 202 3 lolB Outer-membrane lipoprotein LolB Yersinia pestis (strain Pestoides F)
Q1CJK3 1.56e-72 221 56 2 202 3 lolB Outer-membrane lipoprotein LolB Yersinia pestis bv. Antiqua (strain Nepal516)
A9QZ10 1.56e-72 221 56 2 202 3 lolB Outer-membrane lipoprotein LolB Yersinia pestis bv. Antiqua (strain Angola)
Q8ZEY0 1.56e-72 221 56 2 202 3 lolB Outer-membrane lipoprotein LolB Yersinia pestis
Q1C856 1.56e-72 221 56 2 202 3 lolB Outer-membrane lipoprotein LolB Yersinia pestis bv. Antiqua (strain Antiqua)
Q66AX7 2.24e-72 221 56 2 202 3 lolB Outer-membrane lipoprotein LolB Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K2Y8 2.24e-72 221 56 2 202 3 lolB Outer-membrane lipoprotein LolB Yersinia pseudotuberculosis serotype IB (strain PB1/+)
B7NUX5 2.98e-72 221 52 2 202 3 lolB Outer-membrane lipoprotein LolB Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7UQ97 4.61e-72 220 52 2 202 3 lolB Outer-membrane lipoprotein LolB Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B1JM87 4.87e-72 220 56 2 203 3 lolB Outer-membrane lipoprotein LolB Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
B1LH91 7.7e-72 219 52 2 202 3 lolB Outer-membrane lipoprotein LolB Escherichia coli (strain SMS-3-5 / SECEC)
B7MTZ3 7.7e-72 219 52 2 202 3 lolB Outer-membrane lipoprotein LolB Escherichia coli O81 (strain ED1a)
B7MKB1 7.7e-72 219 52 2 202 3 lolB Outer-membrane lipoprotein LolB Escherichia coli O45:K1 (strain S88 / ExPEC)
P61322 1.99e-71 218 51 2 202 3 lolB Outer-membrane lipoprotein LolB Shigella flexneri
Q0T5I6 1.99e-71 218 51 2 202 3 lolB Outer-membrane lipoprotein LolB Shigella flexneri serotype 5b (strain 8401)
Q31ZQ2 1.99e-71 218 51 2 202 3 lolB Outer-membrane lipoprotein LolB Shigella boydii serotype 4 (strain Sb227)
B6I9S4 1.99e-71 218 51 2 202 3 lolB Outer-membrane lipoprotein LolB Escherichia coli (strain SE11)
B7N420 1.99e-71 218 51 2 202 3 lolB Outer-membrane lipoprotein LolB Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P61320 1.99e-71 218 51 2 202 1 lolB Outer-membrane lipoprotein LolB Escherichia coli (strain K12)
B1IU84 1.99e-71 218 51 2 202 3 lolB Outer-membrane lipoprotein LolB Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A7ZZE5 1.99e-71 218 51 2 202 3 lolB Outer-membrane lipoprotein LolB Escherichia coli O9:H4 (strain HS)
B1XAQ0 1.99e-71 218 51 2 202 3 lolB Outer-membrane lipoprotein LolB Escherichia coli (strain K12 / DH10B)
C4ZTQ0 1.99e-71 218 51 2 202 3 lolB Outer-membrane lipoprotein LolB Escherichia coli (strain K12 / MC4100 / BW2952)
B7LXC4 1.99e-71 218 51 2 202 3 lolB Outer-membrane lipoprotein LolB Escherichia coli O8 (strain IAI1)
B5YXM7 1.99e-71 218 51 2 202 3 lolB Outer-membrane lipoprotein LolB Escherichia coli O157:H7 (strain EC4115 / EHEC)
P61321 1.99e-71 218 51 2 202 3 lolB Outer-membrane lipoprotein LolB Escherichia coli O157:H7
B7LGX0 1.99e-71 218 51 2 202 3 lolB Outer-membrane lipoprotein LolB Escherichia coli (strain 55989 / EAEC)
A7ZKY3 1.99e-71 218 51 2 202 3 lolB Outer-membrane lipoprotein LolB Escherichia coli O139:H28 (strain E24377A / ETEC)
Q3Z0S7 2.15e-71 218 51 2 202 3 lolB Outer-membrane lipoprotein LolB Shigella sonnei (strain Ss046)
Q32GZ8 3.12e-71 218 51 2 202 3 lolB Outer-membrane lipoprotein LolB Shigella dysenteriae serotype 1 (strain Sd197)
Q7N588 8.05e-71 217 57 1 187 3 lolB Outer-membrane lipoprotein LolB Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B2TZV7 1.08e-70 217 51 2 202 3 lolB Outer-membrane lipoprotein LolB Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
A1JRU9 2.92e-70 216 54 0 176 3 lolB Outer-membrane lipoprotein LolB Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A4WBC8 1.05e-68 211 48 1 203 3 lolB Outer-membrane lipoprotein LolB Enterobacter sp. (strain 638)
B5XW49 4.3e-68 210 49 1 201 3 lolB Outer-membrane lipoprotein LolB Klebsiella pneumoniae (strain 342)
A6TAP1 1.8e-67 208 49 1 201 3 lolB Outer-membrane lipoprotein LolB Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
C6DHY3 7.08e-67 207 48 1 201 3 lolB Outer-membrane lipoprotein LolB Pectobacterium carotovorum subsp. carotovorum (strain PC1)
B2VEI1 2.4e-64 201 50 0 201 3 lolB Outer-membrane lipoprotein LolB Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q2NRS2 1.55e-63 198 51 0 174 3 lolB Outer-membrane lipoprotein LolB Sodalis glossinidius (strain morsitans)
Q6D553 1.58e-61 193 47 1 186 3 lolB Outer-membrane lipoprotein LolB Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
C4K7Y9 3.45e-46 154 41 2 209 3 lolB Outer-membrane lipoprotein LolB Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
Q1LTH4 9.9e-40 138 31 2 207 3 lolB Outer-membrane lipoprotein LolB Baumannia cicadellinicola subsp. Homalodisca coagulata
A4SK62 4.8e-30 112 34 6 201 3 lolB Outer-membrane lipoprotein LolB Aeromonas salmonicida (strain A449)
Q65SB9 2.08e-28 108 26 3 209 3 lolB Outer-membrane lipoprotein LolB Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
P57834 1.82e-26 103 29 4 200 3 lolB Outer-membrane lipoprotein LolB Pasteurella multocida (strain Pm70)
Q87RN6 2.02e-26 103 29 5 207 3 lolB Outer-membrane lipoprotein LolB Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A0KN00 6.63e-26 102 35 3 168 3 lolB Outer-membrane lipoprotein LolB Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A7MY80 2.87e-25 100 31 3 179 3 lolB Outer-membrane lipoprotein LolB Vibrio campbellii (strain ATCC BAA-1116)
Q7MMY8 1.35e-24 99 29 5 202 3 lolB Outer-membrane lipoprotein LolB Vibrio vulnificus (strain YJ016)
P57070 2.57e-24 98 32 2 179 1 lolB Outer-membrane lipoprotein LolB Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8DFF7 1.18e-23 96 28 5 202 3 lolB Outer-membrane lipoprotein LolB Vibrio vulnificus (strain CMCP6)
B7VKH1 3.61e-23 95 28 5 217 3 lolB Outer-membrane lipoprotein LolB Vibrio atlanticus (strain LGP32)
Q7VL53 3.31e-22 92 23 2 201 3 lolB Outer-membrane lipoprotein LolB Haemophilus ducreyi (strain 35000HP / ATCC 700724)
C4LBL3 4.23e-22 92 30 5 200 3 lolB Outer-membrane lipoprotein LolB Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
A5UCK1 1.01e-20 89 25 5 205 3 lolB Outer-membrane lipoprotein LolB Haemophilus influenzae (strain PittEE)
P45270 1.22e-20 88 25 5 212 3 lolB Outer-membrane lipoprotein LolB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A1STE0 1.8e-20 88 30 5 193 3 lolB Outer-membrane lipoprotein LolB Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
B0BP58 3.88e-20 87 26 3 210 3 lolB Outer-membrane lipoprotein LolB Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3H1B8 3.88e-20 87 26 3 210 3 lolB Outer-membrane lipoprotein LolB Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N0D9 4.3e-20 87 26 3 210 3 lolB Outer-membrane lipoprotein LolB Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q4QL42 7.13e-20 86 25 5 212 3 lolB Outer-membrane lipoprotein LolB Haemophilus influenzae (strain 86-028NP)
A5UJ22 9.28e-20 86 25 4 198 3 lolB Outer-membrane lipoprotein LolB Haemophilus influenzae (strain PittGG)
O52727 1.16e-19 86 25 0 173 3 lolB Outer-membrane lipoprotein LolB Aggregatibacter actinomycetemcomitans
B8F845 1.04e-17 80 24 2 195 3 lolB Outer-membrane lipoprotein LolB Glaesserella parasuis serovar 5 (strain SH0165)
A4XR58 5.3e-16 76 27 5 202 3 lolB Outer-membrane lipoprotein LolB Pseudomonas mendocina (strain ymp)
Q4K692 4.6e-15 73 25 5 202 3 lolB Outer-membrane lipoprotein LolB Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
C3KDC3 1.14e-13 70 24 5 202 3 lolB Outer-membrane lipoprotein LolB Pseudomonas fluorescens (strain SBW25)
A1WVQ5 2.82e-13 68 23 3 171 3 lolB Outer-membrane lipoprotein LolB Halorhodospira halophila (strain DSM 244 / SL1)
Q3K6W6 6.66e-13 68 24 5 202 3 lolB Outer-membrane lipoprotein LolB Pseudomonas fluorescens (strain Pf0-1)
Q0AC01 8.02e-13 67 24 6 197 3 lolB Outer-membrane lipoprotein LolB Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
A1K3G9 1.45e-12 67 25 2 142 3 lolB Outer-membrane lipoprotein LolB Azoarcus sp. (strain BH72)
B0KND8 1.78e-12 67 25 5 202 3 lolB Outer-membrane lipoprotein LolB Pseudomonas putida (strain GB-1)
Q1QXC9 1.8e-12 67 24 4 182 3 lolB Outer-membrane lipoprotein LolB Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
B1JEP9 1.81e-12 66 25 5 202 3 lolB Outer-membrane lipoprotein LolB Pseudomonas putida (strain W619)
Q4ZXX0 3.44e-12 66 25 5 202 3 lolB Outer-membrane lipoprotein LolB Pseudomonas syringae pv. syringae (strain B728a)
A1U370 4.03e-12 65 23 4 181 3 lolB Outer-membrane lipoprotein LolB Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q888C4 5.02e-12 65 24 5 202 3 lolB Outer-membrane lipoprotein LolB Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q48MV7 5.12e-12 65 24 4 202 3 lolB Outer-membrane lipoprotein LolB Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q88PX4 1.13e-11 64 25 5 202 3 lolB Outer-membrane lipoprotein LolB Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5VYG2 1.79e-11 63 24 4 190 3 lolB Outer-membrane lipoprotein LolB Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q12QS0 3e-11 63 24 3 161 3 lolB Outer-membrane lipoprotein LolB Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q1IEY4 4.96e-11 62 24 5 202 3 lolB Outer-membrane lipoprotein LolB Pseudomonas entomophila (strain L48)
A1S8R4 1.03e-10 62 26 7 207 3 lolB Outer-membrane lipoprotein LolB Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
A6VC64 1.77e-10 61 25 4 168 3 lolB Outer-membrane lipoprotein LolB Pseudomonas aeruginosa (strain PA7)
A0Q491 2.74e-10 60 23 5 203 3 lolB Outer-membrane lipoprotein LolB Francisella tularensis subsp. novicida (strain U112)
Q0BP05 3.46e-10 60 23 5 203 3 lolB Outer-membrane lipoprotein LolB Francisella tularensis subsp. holarctica (strain OSU18)
A7N9I7 3.46e-10 60 23 5 203 3 lolB Outer-membrane lipoprotein LolB Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
A9I6X6 4.07e-10 60 29 3 119 3 lolB Outer-membrane lipoprotein LolB Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
A4VPC2 6.36e-10 59 23 4 173 3 lolB Outer-membrane lipoprotein LolB Stutzerimonas stutzeri (strain A1501)
P42812 7.44e-10 59 23 4 168 3 lolB Outer-membrane lipoprotein LolB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02G06 7.44e-10 59 23 4 168 3 lolB Outer-membrane lipoprotein LolB Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V0L4 7.44e-10 59 23 4 168 3 lolB Outer-membrane lipoprotein LolB Pseudomonas aeruginosa (strain LESB58)
B6J9C8 7.7e-10 59 21 3 200 3 lolB Outer-membrane lipoprotein LolB Coxiella burnetii (strain CbuK_Q154)
Q83AQ2 8.01e-10 59 22 5 203 1 lolB Outer-membrane lipoprotein LolB Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NAS3 1.02e-09 59 22 5 203 3 lolB Outer-membrane lipoprotein LolB Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KF01 1.02e-09 59 22 5 203 3 lolB Outer-membrane lipoprotein LolB Coxiella burnetii (strain Dugway 5J108-111)
B6J319 1.02e-09 59 22 5 203 3 lolB Outer-membrane lipoprotein LolB Coxiella burnetii (strain CbuG_Q212)
Q479M4 2.14e-09 58 27 5 142 3 lolB Outer-membrane lipoprotein LolB Dechloromonas aromatica (strain RCB)
Q3IK97 2.99e-09 57 25 6 206 3 lolB Outer-membrane lipoprotein LolB Pseudoalteromonas translucida (strain TAC 125)
Q3JDR1 5.27e-09 57 23 5 198 3 lolB Outer-membrane lipoprotein LolB Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
A4IZZ3 1.05e-08 56 24 4 162 3 lolB Outer-membrane lipoprotein LolB Francisella tularensis subsp. tularensis (strain WY96-3418)
A3QH32 1.19e-08 56 25 4 166 3 lolB Outer-membrane lipoprotein LolB Shewanella loihica (strain ATCC BAA-1088 / PV-4)
A6WSF2 1.35e-08 56 27 5 191 3 lolB Outer-membrane lipoprotein LolB Shewanella baltica (strain OS185)
A3D0F9 1.44e-08 56 27 5 191 3 lolB Outer-membrane lipoprotein LolB Shewanella baltica (strain OS155 / ATCC BAA-1091)
B3PJN9 1.76e-08 55 25 4 163 3 lolB Outer-membrane lipoprotein LolB Cellvibrio japonicus (strain Ueda107)
Q5NI20 2.02e-08 55 24 4 162 3 lolB Outer-membrane lipoprotein LolB Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q14JH2 2.02e-08 55 24 4 162 3 lolB Outer-membrane lipoprotein LolB Francisella tularensis subsp. tularensis (strain FSC 198)
Q8PC65 2.97e-08 55 24 7 220 3 lolB Outer-membrane lipoprotein LolB Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4URB9 2.97e-08 55 24 7 220 3 lolB Outer-membrane lipoprotein LolB Xanthomonas campestris pv. campestris (strain 8004)
Q7WNY6 1.07e-07 53 28 4 124 3 lolB Outer-membrane lipoprotein LolB Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q7W183 1.08e-07 53 28 4 124 3 lolB Outer-membrane lipoprotein LolB Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7VUG9 1.18e-07 53 28 4 124 3 lolB Outer-membrane lipoprotein LolB Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
B0RUA2 2.88e-07 52 25 5 144 1 lolB Outer-membrane lipoprotein LolB Xanthomonas campestris pv. campestris (strain B100)
B8E817 3.21e-07 52 26 5 191 3 lolB Outer-membrane lipoprotein LolB Shewanella baltica (strain OS223)
A9L2D6 4.79e-07 52 26 5 191 3 lolB Outer-membrane lipoprotein LolB Shewanella baltica (strain OS195)
Q0HFC6 7.64e-07 51 21 5 208 3 lolB Outer-membrane lipoprotein LolB Shewanella sp. (strain MR-4)
Q7NQS7 9.2e-07 50 23 4 137 3 lolB Outer-membrane lipoprotein LolB Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q5GWR2 1.49e-06 50 21 6 219 3 lolB Outer-membrane lipoprotein LolB Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SQN8 1.49e-06 50 21 6 219 3 lolB Outer-membrane lipoprotein LolB Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2NZW5 1.49e-06 50 21 6 219 3 lolB Outer-membrane lipoprotein LolB Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
A0KT86 2.29e-06 50 21 5 208 3 lolB Outer-membrane lipoprotein LolB Shewanella sp. (strain ANA-3)
A8FYZ2 2.93e-06 49 22 3 192 3 lolB Outer-membrane lipoprotein LolB Shewanella sediminis (strain HAW-EB3)
Q0HYL0 3.9e-06 49 21 5 208 3 lolB Outer-membrane lipoprotein LolB Shewanella sp. (strain MR-7)
Q8EAR1 4.21e-06 49 22 6 209 3 lolB Outer-membrane lipoprotein LolB Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q8PNU2 9.96e-06 48 23 5 145 3 lolB Outer-membrane lipoprotein LolB Xanthomonas axonopodis pv. citri (strain 306)
Q1LRP9 1.37e-05 47 26 9 207 3 lolB Outer-membrane lipoprotein LolB Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q3BX04 1.67e-05 47 21 8 219 3 lolB Outer-membrane lipoprotein LolB Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
P57023 2.07e-05 47 25 4 151 3 lolB Outer-membrane lipoprotein LolB Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q087I6 4.99e-05 45 21 4 191 3 lolB Outer-membrane lipoprotein LolB Shewanella frigidimarina (strain NCIMB 400)
B1KDU5 6.77e-05 45 26 5 167 3 lolB Outer-membrane lipoprotein LolB Shewanella woodyi (strain ATCC 51908 / MS32)
P57024 0.000163 44 26 5 151 3 lolB Outer-membrane lipoprotein LolB Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
A1RNE3 0.000396 43 25 2 97 3 lolB Outer-membrane lipoprotein LolB Shewanella sp. (strain W3-18-1)
A4Y3J6 0.000396 43 25 2 97 3 lolB Outer-membrane lipoprotein LolB Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A6W1C5 0.0006 42 18 2 163 3 lolB Outer-membrane lipoprotein LolB Marinomonas sp. (strain MWYL1)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_01915
Feature type CDS
Gene lolB
Product lipoprotein insertase outer membrane protein LolB
Location 70248 - 70877 (strand: -1)
Length 630 (nucleotides) / 209 (amino acids)

Contig

Accession contig_2
Length 292399 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_609
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF03550 Outer membrane lipoprotein LolB

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3017 Cell wall/membrane/envelope biogenesis (M) M Outer membrane lipoprotein LolB, involved in outer membrane biogenesis

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02494 outer membrane lipoprotein LolB - -

Protein Sequence

MASIQLPRFIRLLPLCSLILAACTLPDNTEKGDVSATSAGWKAQTEQINQLQRYQTRGSFAYIGTTQKTYARFFWQQYSPDNYKLLLTNPVGSTELELIVKDGQTQLTDNKGQKYYSDDPDSMIYQLTGMTIPMENLRQWIVGLPGDAQSYAISNQYHLKALSWAQGMEKWKVTYQSYDEKVSPQLPNRLDIEQGDNRIKLKMDSWTLN

Flanking regions ( +/- flanking 50bp)

CAGGCACAATACTGTTATTGCTTTTATAAGTTGTTAAAGGAAATTACAACGTGGCCTCTATTCAATTACCGCGCTTTATCCGGCTTCTGCCCCTGTGCAGCCTGATACTTGCCGCCTGTACCCTGCCTGACAATACAGAGAAAGGCGATGTTTCCGCCACCTCTGCCGGCTGGAAAGCACAGACAGAACAGATAAATCAGTTACAGCGTTATCAGACGCGCGGCTCGTTTGCCTACATCGGTACCACCCAGAAAACCTATGCCCGTTTCTTCTGGCAGCAGTATTCCCCGGACAACTACAAACTGCTGCTCACCAACCCGGTCGGCAGCACCGAGCTGGAACTGATTGTCAAAGACGGTCAGACCCAACTGACCGATAACAAAGGTCAGAAATATTACAGTGATGATCCGGACAGCATGATTTACCAGCTGACCGGTATGACTATCCCGATGGAAAATCTGCGTCAGTGGATTGTCGGCCTGCCGGGTGACGCGCAGTCCTATGCCATCAGCAATCAGTATCACCTGAAAGCGCTGAGCTGGGCTCAGGGCATGGAAAAGTGGAAAGTCACTTATCAGTCCTATGATGAAAAAGTCTCCCCGCAACTGCCGAACCGCCTGGATATCGAACAGGGTGATAACCGCATCAAGCTGAAAATGGATTCATGGACACTCAACTGACATCACTGACCTGGCCGTCCCCCGCCAAGCTGAACCTGTTTTTATATATC