Homologs in group_2485

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_00260 EHELCC_00260 100.0 Morganella morganii S2 - RHS repeat protein
NLDBIP_03200 NLDBIP_03200 100.0 Morganella morganii S4 - RHS repeat protein
LHKJJB_04715 LHKJJB_04715 100.0 Morganella morganii S3 - RHS repeat protein
HKOGLL_02330 HKOGLL_02330 100.0 Morganella morganii S5 - RHS repeat protein
PMI_RS03745 PMI_RS03745 56.3 Proteus mirabilis HI4320 - RHS repeat protein

Distribution of the homologs in the orthogroup group_2485

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2485

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0DUH5 6.35e-18 84 31 2 189 1 dddA Double-stranded DNA deaminase toxin A Burkholderia cenocepacia (strain H111)
P0DUH5 2.84e-08 56 26 3 172 1 dddA Double-stranded DNA deaminase toxin A Burkholderia cenocepacia (strain H111)
P0DUH5 2.12e-07 53 26 5 197 1 dddA Double-stranded DNA deaminase toxin A Burkholderia cenocepacia (strain H111)
P0DUH5 7e-07 52 26 3 180 1 dddA Double-stranded DNA deaminase toxin A Burkholderia cenocepacia (strain H111)
P0DUH5 4.29e-06 50 29 3 141 1 dddA Double-stranded DNA deaminase toxin A Burkholderia cenocepacia (strain H111)
Q9I0F4 4.58e-15 76 34 0 145 4 tse5 Toxin protein Tse5 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9I0F4 3.33e-12 67 30 0 138 4 tse5 Toxin protein Tse5 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9I0F4 4.07e-07 52 27 0 142 4 tse5 Toxin protein Tse5 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9I0F4 2.23e-06 50 28 4 176 4 tse5 Toxin protein Tse5 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9I0F4 0.000282 44 30 2 105 4 tse5 Toxin protein Tse5 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9I0F4 0.000851 43 25 4 177 4 tse5 Toxin protein Tse5 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P16919 6.71e-14 72 29 3 192 2 rhsD Protein RhsD Escherichia coli (strain K12)
P16919 8.56e-10 60 31 3 166 2 rhsD Protein RhsD Escherichia coli (strain K12)
P16919 1.11e-09 60 30 4 142 2 rhsD Protein RhsD Escherichia coli (strain K12)
P16918 4.21e-12 67 28 3 214 1 rhsC Protein RhsC Escherichia coli (strain K12)
P16918 1.55e-09 60 31 3 167 1 rhsC Protein RhsC Escherichia coli (strain K12)
P16918 1.19e-06 51 25 3 188 1 rhsC Protein RhsC Escherichia coli (strain K12)
P16918 9.67e-06 48 28 4 141 1 rhsC Protein RhsC Escherichia coli (strain K12)
P16918 1.06e-05 48 31 7 155 1 rhsC Protein RhsC Escherichia coli (strain K12)
P16917 1.06e-11 66 28 3 214 3 rhsB Protein RhsB Escherichia coli (strain K12)
P16917 3.68e-09 58 31 3 167 3 rhsB Protein RhsB Escherichia coli (strain K12)
P16917 2.08e-07 53 26 3 188 3 rhsB Protein RhsB Escherichia coli (strain K12)
P16917 3.03e-06 50 28 4 142 3 rhsB Protein RhsB Escherichia coli (strain K12)
P16917 9.86e-06 48 31 7 155 3 rhsB Protein RhsB Escherichia coli (strain K12)
P16917 3.14e-05 47 25 6 209 3 rhsB Protein RhsB Escherichia coli (strain K12)
P16916 1.14e-11 66 28 3 214 3 rhsA Protein RhsA Escherichia coli (strain K12)
P16916 3.96e-09 58 31 3 167 3 rhsA Protein RhsA Escherichia coli (strain K12)
P16916 2.5e-07 53 26 3 188 3 rhsA Protein RhsA Escherichia coli (strain K12)
P16916 2.94e-06 50 28 4 142 3 rhsA Protein RhsA Escherichia coli (strain K12)
P16916 9.04e-06 48 31 7 155 3 rhsA Protein RhsA Escherichia coli (strain K12)
P16916 3.05e-05 47 25 6 209 3 rhsA Protein RhsA Escherichia coli (strain K12)
E0SIS2 6.99e-11 63 24 2 189 1 rhsB Probable deoxyribonuclease RhsB Dickeya dadantii (strain 3937)
E0SIS2 2.19e-05 47 25 2 154 1 rhsB Probable deoxyribonuclease RhsB Dickeya dadantii (strain 3937)
E0SAK8 2.31e-10 62 24 3 189 1 rhsA Probable deoxyribonuclease RhsA Dickeya dadantii (strain 3937)
E0SAK8 4.75e-06 49 25 2 154 1 rhsA Probable deoxyribonuclease RhsA Dickeya dadantii (strain 3937)
E0SAK8 0.001 43 25 3 162 1 rhsA Probable deoxyribonuclease RhsA Dickeya dadantii (strain 3937)
Q07833 8.78e-10 60 27 2 151 1 wapA tRNA nuclease WapA Bacillus subtilis (strain 168)
Q07833 8.14e-08 55 28 6 174 1 wapA tRNA nuclease WapA Bacillus subtilis (strain 168)
Q07833 9.12e-08 54 25 2 182 1 wapA tRNA nuclease WapA Bacillus subtilis (strain 168)
D4G3R4 4.11e-09 58 27 2 151 1 wapA tRNA(Glu)-specific nuclease WapA Bacillus subtilis subsp. natto (strain BEST195)
D4G3R4 1.61e-08 57 25 2 182 1 wapA tRNA(Glu)-specific nuclease WapA Bacillus subtilis subsp. natto (strain BEST195)
D4G3R4 1.32e-07 54 28 6 174 1 wapA tRNA(Glu)-specific nuclease WapA Bacillus subtilis subsp. natto (strain BEST195)
E0SGL7 8.26e-09 57 27 3 168 1 rhsC Putative deoxyribonuclease RhsC Dickeya dadantii (strain 3937)
E0SGL7 1.68e-07 53 32 0 118 1 rhsC Putative deoxyribonuclease RhsC Dickeya dadantii (strain 3937)
E0SGL7 2.84e-06 50 28 3 166 1 rhsC Putative deoxyribonuclease RhsC Dickeya dadantii (strain 3937)
E0SGL7 9.8e-06 48 29 4 163 1 rhsC Putative deoxyribonuclease RhsC Dickeya dadantii (strain 3937)
E0SGL7 1.29e-05 48 25 4 166 1 rhsC Putative deoxyribonuclease RhsC Dickeya dadantii (strain 3937)
G4NYJ6 1e-08 57 26 2 151 1 wapA tRNA3(Ser)-specific nuclease WapA Bacillus spizizenii (strain DSM 15029 / JCM 12233 / NBRC 101239 / NRRL B-23049 / TU-B-10)
G4NYJ6 9.03e-08 54 25 2 182 1 wapA tRNA3(Ser)-specific nuclease WapA Bacillus spizizenii (strain DSM 15029 / JCM 12233 / NBRC 101239 / NRRL B-23049 / TU-B-10)
G4NYJ6 4.31e-07 52 28 6 174 1 wapA tRNA3(Ser)-specific nuclease WapA Bacillus spizizenii (strain DSM 15029 / JCM 12233 / NBRC 101239 / NRRL B-23049 / TU-B-10)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_01285
Feature type CDS
Gene -
Product RHS repeat protein
Location 247669 - 248247 (strand: -1)
Length 579 (nucleotides) / 192 (amino acids)

Contig

Accession contig_1
Length 309072 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2485
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF05593 RHS Repeat

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3209 General function prediction only (R) R Uncharacterized conserved protein RhaS, contains 28 RHS repeats

Protein Sequence

MDPLGHATRLVWDEQGDCLQQTDPGGSITRYRYNTRGQLTRYTDCSGYHTTLAYDERGQLTTITDALSQTTCYHWSEGGQLLREELPDGRDNRYSYDDAGRVTGFTDSGDKKITFARNIFGQITERTDPAGYRLGFRYDRFGRPKVLVNEKDESYRFEYDALHRLIRRGTSGRNMIMTSPGTEPAATPGHIH

Flanking regions ( +/- flanking 50bp)

ATTTTATTTACTGTGCTACCTGAAACACCAAAGGGGATATCCATCTGTTTATGGATCCGCTGGGGCATGCCACCCGGCTGGTATGGGATGAGCAGGGGGACTGTCTTCAGCAGACTGACCCGGGCGGCAGCATCACCCGTTACCGCTACAATACCCGCGGACAGCTGACCCGTTATACCGACTGCTCCGGTTATCACACCACACTGGCCTATGATGAGCGCGGGCAACTGACCACGATCACCGATGCACTGAGCCAGACCACTTGCTATCACTGGTCGGAGGGCGGACAGCTGTTGCGGGAGGAATTACCGGACGGCCGTGACAACCGCTATTCCTATGACGATGCCGGGCGTGTCACCGGGTTTACCGACAGCGGCGATAAAAAAATTACCTTCGCCCGTAATATCTTCGGGCAAATCACTGAGCGTACCGACCCGGCGGGATACCGTCTCGGCTTCCGTTACGACCGCTTCGGGCGGCCGAAAGTGCTGGTCAATGAAAAAGACGAATCTTACCGGTTTGAATATGACGCACTGCACCGCCTGATCCGCAGAGGAACCAGCGGGCGGAATATGATTATGACATCTCCGGGCACAGAACCGGCGGCCACTCCTGGCCACATCCATTAAAAATTATTTTAAAAACCATAACTATTTTGATAAATAACAAGTCTGCTTTG