Homologs in group_75

Help

11 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_11160 FBDBKF_11160 54.8 Morganella morganii S1 - DUF2591 domain-containing protein
EHELCC_01200 EHELCC_01200 100.0 Morganella morganii S2 - DUF2591 domain-containing protein
EHELCC_05065 EHELCC_05065 54.8 Morganella morganii S2 - DUF2591 domain-containing protein
NLDBIP_02260 NLDBIP_02260 100.0 Morganella morganii S4 - DUF2591 domain-containing protein
NLDBIP_05385 NLDBIP_05385 54.8 Morganella morganii S4 - DUF2591 domain-containing protein
LHKJJB_02265 LHKJJB_02265 54.8 Morganella morganii S3 - DUF2591 domain-containing protein
LHKJJB_03775 LHKJJB_03775 100.0 Morganella morganii S3 - DUF2591 domain-containing protein
HKOGLL_03270 HKOGLL_03270 100.0 Morganella morganii S5 - DUF2591 domain-containing protein
HKOGLL_15645 HKOGLL_15645 54.8 Morganella morganii S5 - DUF2591 domain-containing protein
F4V73_RS06320 F4V73_RS06320 46.7 Morganella psychrotolerans - phage protein NinX family protein
PMI_RS02295 PMI_RS02295 48.9 Proteus mirabilis HI4320 - DUF2591 family protein

Distribution of the homologs in the orthogroup group_75

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_75

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q38665 2.77e-17 73 42 3 108 4 ninX Putative protein ninX Salmonella phage P22

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_00345
Feature type CDS
Gene -
Product DUF2591 domain-containing protein
Location 44955 - 45263 (strand: 1)
Length 309 (nucleotides) / 102 (amino acids)
In genomic island -

Contig

Accession contig_1
Length 309072 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_75
Orthogroup size 12
N. genomes 7

Actions

Genomic region

Domains

PF10765 Bacteriophage P22, NinX

Protein Sequence

MNKYRDKSDFEINKAVAAFNGMVRYNVVESDEKIYTSFDEFDPCNNPADAWPIINEYGISLIYQEREFQFATNDGNIECSISNPLKAAMIIFLMMKDAENES

Flanking regions ( +/- flanking 50bp)

AGTTGGTTTATTGATGCTAACGAAATTGATATATCAGGATGGTAACAGCAATGAACAAATATCGTGACAAATCAGACTTTGAGATTAATAAGGCTGTGGCCGCATTTAATGGCATGGTTCGCTACAATGTTGTTGAGTCTGACGAGAAAATTTATACATCATTCGATGAGTTCGACCCCTGCAACAACCCGGCGGACGCATGGCCGATTATTAATGAGTATGGTATTAGCCTTATATATCAAGAGAGAGAGTTCCAGTTTGCAACTAACGACGGAAATATAGAGTGCAGCATTAGCAATCCATTAAAAGCCGCAATGATTATTTTCCTGATGATGAAGGATGCGGAGAATGAAAGCTGACTACGGCGGGAGCACAACACCAAAGGAATTGCGTGATTTGTGGCAAACTC