Homologs in group_3642

Help

4 homologs were identified in 3 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
NLDBIP_19040 NLDBIP_19040 75.0 Morganella morganii S4 - DUF2570 domain-containing protein
LHKJJB_18930 LHKJJB_18930 75.0 Morganella morganii S3 - DUF2570 domain-containing protein
F4V73_RS02065 F4V73_RS02065 81.8 Morganella psychrotolerans - hypothetical protein
F4V73_RS02290 F4V73_RS02290 - Morganella psychrotolerans - hypothetical protein

Distribution of the homologs in the orthogroup group_3642

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3642

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS19565
Feature type CDS
Gene -
Product hypothetical protein
Location 483114 - 483248 (strand: 1)
Length 135 (nucleotides) / 44 (amino acids)
In genomic island GI67

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3642
Orthogroup size 5
N. genomes 3

Actions

Genomic region

Protein Sequence

MKKIISVLFNGWLWAVVFFGLWMFSLLSAGQSEGQHKDKVISKR

Flanking regions ( +/- flanking 50bp)

CTGCCGGGGTATCCGCAGGCTGGGGTGATTAATTATCAGTGTGAATAATTATGAAAAAGATTATTTCTGTCTTATTTAACGGCTGGTTATGGGCGGTGGTGTTTTTCGGGCTTTGGATGTTCAGCCTGCTGTCAGCCGGGCAATCGGAAGGGCAGCATAAAGACAAAGTGATCAGCAAAAGGTGATTGATAACGCCTACACCAGCTTTAATATCTTTGACCGCGCTGCTGCCGAG