Homologs in group_1748

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_11900 FBDBKF_11900 86.7 Morganella morganii S1 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB
EHELCC_14405 EHELCC_14405 86.7 Morganella morganii S2 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB
NLDBIP_15500 NLDBIP_15500 86.7 Morganella morganii S4 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB
LHKJJB_15110 LHKJJB_15110 86.7 Morganella morganii S3 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB
HKOGLL_14230 HKOGLL_14230 86.7 Morganella morganii S5 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB
PMI_RS13990 PMI_RS13990 66.5 Proteus mirabilis HI4320 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB

Distribution of the homologs in the orthogroup group_1748

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1748

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P32125 3.07e-62 192 58 2 165 1 mobB Molybdopterin-guanine dinucleotide biosynthesis adapter protein Escherichia coli (strain K12)
P44902 5.72e-43 144 45 3 161 1 mobB Molybdopterin-guanine dinucleotide biosynthesis adapter protein Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q58720 4.44e-12 65 30 4 119 3 mobB Putative molybdopterin-guanine dinucleotide biosynthesis adapter protein Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
O31704 1.56e-06 49 28 2 117 3 mobB Probable molybdopterin-guanine dinucleotide biosynthesis adapter protein Bacillus subtilis (strain 168)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS19520
Feature type CDS
Gene mobB
Product molybdopterin-guanine dinucleotide biosynthesis protein MobB
Location 185507 - 186013 (strand: -1)
Length 507 (nucleotides) / 168 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000004
Length 258164 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1748
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF03205 Molybdopterin guanine dinucleotide synthesis protein B

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1763 Coenzyme transport and metabolism (H) H Molybdopterin-guanine dinucleotide biosynthesis protein

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03753 molybdopterin-guanine dinucleotide biosynthesis adapter protein - -

Protein Sequence

MAVTAYSGTGKTTMLKKLIPLLRDAGLRIGLVKHTHHDMDVDTPGKDSYELRKAGAYQTLVVSQERFALMTETPGGAEPDLAQLAARFDSRQLDLILVEGFKGEAVPKIALYRDVVDRPYQTLLDEFVIAFACDIPRSDVSVPQMDINDIAAIRDFIVRWLTENPLNP

Flanking regions ( +/- flanking 50bp)

AGTGCCGTGAATGGGAAAAACAGCATCAGTTACCCCACCCGGTTCCGTTACTGGCTGTCACGGCTTACAGCGGCACCGGCAAAACGACCATGCTGAAAAAGCTTATTCCGCTGTTGCGGGATGCCGGTCTGCGGATTGGTCTGGTCAAACACACGCATCACGATATGGATGTGGATACCCCGGGGAAAGACAGTTACGAACTGCGCAAAGCAGGTGCGTACCAAACCCTGGTGGTCAGTCAGGAACGTTTTGCACTGATGACGGAAACTCCGGGCGGTGCGGAGCCTGATCTTGCACAACTTGCCGCCCGGTTTGACAGCAGGCAGTTGGATCTTATCCTGGTCGAAGGATTTAAAGGCGAAGCGGTGCCGAAAATAGCCCTGTACCGCGATGTGGTTGACCGTCCGTATCAGACACTGCTCGATGAATTTGTGATTGCATTTGCCTGCGACATTCCCCGGAGCGATGTTTCAGTACCACAGATGGATATCAATGATATAGCGGCCATCCGGGATTTTATTGTGCGCTGGCTGACAGAGAATCCGCTTAATCCGTAACCATTACTCATATCGGGACTGATACAAAATGGTGTCTGCCGGCCCGATAT