Homologs in group_179

Help

8 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_04595 FBDBKF_04595 39.2 Morganella morganii S1 - Major facilitator superfamily (MFS) profile domain-containing protein
EHELCC_05885 EHELCC_05885 39.2 Morganella morganii S2 - Major facilitator superfamily (MFS) profile domain-containing protein
NLDBIP_06205 NLDBIP_06205 39.2 Morganella morganii S4 - Major facilitator superfamily (MFS) profile domain-containing protein
LHKJJB_03085 LHKJJB_03085 39.2 Morganella morganii S3 - Major facilitator superfamily (MFS) profile domain-containing protein
HKOGLL_06560 HKOGLL_06560 39.2 Morganella morganii S5 - Major facilitator superfamily (MFS) profile domain-containing protein
F4V73_RS09045 F4V73_RS09045 39.2 Morganella psychrotolerans - linear amide C-N hydrolase
F4V73_RS11330 F4V73_RS11330 37.3 Morganella psychrotolerans - linear amide C-N hydrolase
PMI_RS10435 PMI_RS10435 36.5 Proteus mirabilis HI4320 - linear amide C-N hydrolase

Distribution of the homologs in the orthogroup group_179

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_179

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q6D291 2.19e-06 46 38 1 59 1 pva Penicillin V acylase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS19360
Feature type CDS
Gene -
Product linear amide C-N hydrolase
Location 104103 - 104330 (strand: -1)
Length 228 (nucleotides) / 75 (amino acids)

Contig

Accession term accessions NZ_VXKB01000003 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 425895 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_179
Orthogroup size 9
N. genomes 7

Actions

Genomic region

Domains

PF02275 Linear amide C-N hydrolases, choloylglycine hydrolase family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3049 Cell wall/membrane/envelope biogenesis (M)
General function prediction only (R)		 MR Penicillin V acylase or related amidase, Ntn superfamily

Protein Sequence

MRAVNLLYLNETDVEPRDTSRAGLQIGLWAQYVLDNAATVTDALDELDKVQFVMATGSVNACLKKKRNSSRSPVK

Flanking regions ( +/- flanking 50bp)

TGAGCTAAATGATTAATTAAAATCGGTGTTTGCTCACAGGAAAGTAAACTATCAGAGCCGTCAATTTACTGTATCTGAACGAAACCGATGTGGAGCCACGAGATACATCCCGGGCCGGTCTCCAGATAGGATTGTGGGCGCAGTATGTGTTAGATAACGCAGCCACGGTGACAGATGCGCTGGATGAACTGGATAAAGTGCAGTTTGTTATGGCGACCGGCTCGGTTAATGCCTGCCTTAAAAAGAAAAGAAATTCCTCCCGGAGCCCGGTAAAATAGAATACGGCATATTTTCCGGGAGAAACTCCCATGGAACAACCGGTTTCATA