Homologs in group_2370

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_19100 FBDBKF_19100 91.1 Morganella morganii S1 mscL large-conductance mechanosensitive channel protein MscL
EHELCC_18845 EHELCC_18845 91.1 Morganella morganii S2 mscL large-conductance mechanosensitive channel protein MscL
NLDBIP_18860 NLDBIP_18860 91.1 Morganella morganii S4 mscL large-conductance mechanosensitive channel protein MscL
LHKJJB_18715 LHKJJB_18715 91.1 Morganella morganii S3 mscL large-conductance mechanosensitive channel protein MscL
HKOGLL_18450 HKOGLL_18450 91.1 Morganella morganii S5 mscL large-conductance mechanosensitive channel protein MscL
PMI_RS16290 PMI_RS16290 77.0 Proteus mirabilis HI4320 mscL large-conductance mechanosensitive channel protein MscL

Distribution of the homologs in the orthogroup group_2370

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2370

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4F1L3 3.65e-72 214 77 0 135 3 mscL Large-conductance mechanosensitive channel Proteus mirabilis (strain HI4320)
C6DFR9 2.26e-70 210 74 0 134 3 mscL Large-conductance mechanosensitive channel Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6CZZ8 4.71e-70 209 73 0 135 3 mscL Large-conductance mechanosensitive channel Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A8AQI5 8.79e-70 209 77 1 135 3 mscL Large-conductance mechanosensitive channel Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q1R642 4.31e-69 207 77 0 135 3 mscL Large-conductance mechanosensitive channel Escherichia coli (strain UTI89 / UPEC)
Q8FD11 4.31e-69 207 77 0 135 3 mscL Large-conductance mechanosensitive channel Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TCH1 4.31e-69 207 77 0 135 3 mscL Large-conductance mechanosensitive channel Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AGI2 4.31e-69 207 77 0 135 3 mscL Large-conductance mechanosensitive channel Escherichia coli O1:K1 / APEC
B7N0T1 4.31e-69 207 77 0 135 3 mscL Large-conductance mechanosensitive channel Escherichia coli O81 (strain ED1a)
B7MCQ6 4.31e-69 207 77 0 135 3 mscL Large-conductance mechanosensitive channel Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UK14 4.6e-69 207 77 1 135 3 mscL Large-conductance mechanosensitive channel Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A4WF99 9.08e-69 206 75 0 135 3 mscL Large-conductance mechanosensitive channel Enterobacter sp. (strain 638)
B7LRQ7 1.62e-68 205 77 1 135 3 mscL Large-conductance mechanosensitive channel Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B1LGP7 1.62e-68 205 77 1 135 3 mscL Large-conductance mechanosensitive channel Escherichia coli (strain SMS-3-5 / SECEC)
B6I204 1.62e-68 205 77 1 135 3 mscL Large-conductance mechanosensitive channel Escherichia coli (strain SE11)
B7NDR2 1.62e-68 205 77 1 135 3 mscL Large-conductance mechanosensitive channel Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A742 1.62e-68 205 77 1 135 1 mscL Large-conductance mechanosensitive channel Escherichia coli (strain K12)
B1IQ09 1.62e-68 205 77 1 135 3 mscL Large-conductance mechanosensitive channel Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A595 1.62e-68 205 77 1 135 3 mscL Large-conductance mechanosensitive channel Escherichia coli O9:H4 (strain HS)
B1X6E2 1.62e-68 205 77 1 135 3 mscL Large-conductance mechanosensitive channel Escherichia coli (strain K12 / DH10B)
C4ZUE5 1.62e-68 205 77 1 135 3 mscL Large-conductance mechanosensitive channel Escherichia coli (strain K12 / MC4100 / BW2952)
B7M0Z6 1.62e-68 205 77 1 135 3 mscL Large-conductance mechanosensitive channel Escherichia coli O8 (strain IAI1)
B7NLL0 1.62e-68 205 77 1 135 3 mscL Large-conductance mechanosensitive channel Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YT10 1.62e-68 205 77 1 135 3 mscL Large-conductance mechanosensitive channel Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A743 1.62e-68 205 77 1 135 3 mscL Large-conductance mechanosensitive channel Escherichia coli O157:H7
A7ZSH9 1.62e-68 205 77 1 135 3 mscL Large-conductance mechanosensitive channel Escherichia coli O139:H28 (strain E24377A / ETEC)
Q664V0 6.26e-68 204 74 1 135 3 mscL Large-conductance mechanosensitive channel Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TH19 6.26e-68 204 74 1 135 3 mscL Large-conductance mechanosensitive channel Yersinia pestis (strain Pestoides F)
Q1CCX2 6.26e-68 204 74 1 135 3 mscL Large-conductance mechanosensitive channel Yersinia pestis bv. Antiqua (strain Nepal516)
A9R923 6.26e-68 204 74 1 135 3 mscL Large-conductance mechanosensitive channel Yersinia pestis bv. Antiqua (strain Angola)
Q8ZJ83 6.26e-68 204 74 1 135 3 mscL Large-conductance mechanosensitive channel Yersinia pestis
Q1C2X5 6.26e-68 204 74 1 135 3 mscL Large-conductance mechanosensitive channel Yersinia pestis bv. Antiqua (strain Antiqua)
A7FNK6 6.26e-68 204 74 1 135 3 mscL Large-conductance mechanosensitive channel Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q3YWW9 1.3e-67 203 76 1 135 3 mscL Large-conductance mechanosensitive channel Shigella sonnei (strain Ss046)
Q31VY6 1.3e-67 203 76 1 135 3 mscL Large-conductance mechanosensitive channel Shigella boydii serotype 4 (strain Sb227)
B2U2R0 1.3e-67 203 76 1 135 3 mscL Large-conductance mechanosensitive channel Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LHZ2 1.3e-67 203 76 1 135 3 mscL Large-conductance mechanosensitive channel Escherichia coli (strain 55989 / EAEC)
O68284 2.14e-67 202 72 0 134 3 mscL Large-conductance mechanosensitive channel Pectobacterium carotovorum
A6TEU4 4.21e-67 202 77 0 135 3 mscL Large-conductance mechanosensitive channel Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XNC0 4.21e-67 202 77 0 135 3 mscL Large-conductance mechanosensitive channel Klebsiella pneumoniae (strain 342)
A7MPE5 1.17e-65 198 74 1 135 3 mscL Large-conductance mechanosensitive channel Cronobacter sakazakii (strain ATCC BAA-894)
A8GKG9 2.13e-64 195 75 0 135 3 mscL Large-conductance mechanosensitive channel Serratia proteamaculans (strain 568)
B2VK97 6.52e-64 194 72 1 134 3 mscL Large-conductance mechanosensitive channel Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
P0A1X8 1.12e-63 193 78 0 135 3 mscL Large-conductance mechanosensitive channel Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1X9 1.12e-63 193 78 0 135 3 mscL Large-conductance mechanosensitive channel Salmonella typhi
B4TXB4 1.12e-63 193 78 0 135 3 mscL Large-conductance mechanosensitive channel Salmonella schwarzengrund (strain CVM19633)
B5BGV7 1.12e-63 193 78 0 135 3 mscL Large-conductance mechanosensitive channel Salmonella paratyphi A (strain AKU_12601)
A9N8B5 1.12e-63 193 78 0 135 3 mscL Large-conductance mechanosensitive channel Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PIT4 1.12e-63 193 78 0 135 3 mscL Large-conductance mechanosensitive channel Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SUR2 1.12e-63 193 78 0 135 3 mscL Large-conductance mechanosensitive channel Salmonella newport (strain SL254)
B4TJY1 1.12e-63 193 78 0 135 3 mscL Large-conductance mechanosensitive channel Salmonella heidelberg (strain SL476)
B5RH45 1.12e-63 193 78 0 135 3 mscL Large-conductance mechanosensitive channel Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R1E7 1.12e-63 193 78 0 135 3 mscL Large-conductance mechanosensitive channel Salmonella enteritidis PT4 (strain P125109)
B5FJI6 1.12e-63 193 78 0 135 3 mscL Large-conductance mechanosensitive channel Salmonella dublin (strain CT_02021853)
A9MN76 1.12e-63 193 78 0 135 3 mscL Large-conductance mechanosensitive channel Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5F7R7 1.12e-63 193 78 0 135 3 mscL Large-conductance mechanosensitive channel Salmonella agona (strain SL483)
C0PZV3 9.46e-63 191 77 0 135 3 mscL Large-conductance mechanosensitive channel Salmonella paratyphi C (strain RKS4594)
Q57J60 9.46e-63 191 77 0 135 3 mscL Large-conductance mechanosensitive channel Salmonella choleraesuis (strain SC-B67)
P57950 2.66e-62 189 70 2 134 3 mscL Large-conductance mechanosensitive channel Pasteurella multocida (strain Pm70)
Q48DU1 6.98e-62 189 66 0 135 3 mscL Large-conductance mechanosensitive channel Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
A1JRZ6 9.35e-62 188 74 0 135 3 mscL Large-conductance mechanosensitive channel Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q4ZNG6 2.43e-61 187 67 0 135 3 mscL Large-conductance mechanosensitive channel Pseudomonas syringae pv. syringae (strain B728a)
Q87WB2 1.39e-60 186 66 0 134 3 mscL Large-conductance mechanosensitive channel Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q88E23 5.04e-60 184 65 0 135 3 mscL Large-conductance mechanosensitive channel Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5W917 6.99e-60 184 65 0 135 3 mscL Large-conductance mechanosensitive channel Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q9HVH7 1.29e-59 183 64 1 136 3 mscL Large-conductance mechanosensitive channel Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
B7V0F9 1.29e-59 183 64 1 136 3 mscL Large-conductance mechanosensitive channel Pseudomonas aeruginosa (strain LESB58)
B0KHQ5 1.61e-59 183 64 0 135 3 mscL Large-conductance mechanosensitive channel Pseudomonas putida (strain GB-1)
C1DER3 2.14e-59 182 64 0 135 3 mscL Large-conductance mechanosensitive channel Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q02G63 2.39e-59 182 63 1 136 3 mscL Large-conductance mechanosensitive channel Pseudomonas aeruginosa (strain UCBPP-PA14)
A6VC02 3.36e-59 182 63 1 136 3 mscL Large-conductance mechanosensitive channel Pseudomonas aeruginosa (strain PA7)
Q0HQW4 4e-59 182 62 0 135 3 mscL Large-conductance mechanosensitive channel Shewanella sp. (strain MR-7)
Q0HMW6 4e-59 182 62 0 135 3 mscL Large-conductance mechanosensitive channel Shewanella sp. (strain MR-4)
Q1I4K7 4.22e-59 182 62 0 135 3 mscL Large-conductance mechanosensitive channel Pseudomonas entomophila (strain L48)
A0KSJ1 6.63e-59 181 62 0 135 3 mscL Large-conductance mechanosensitive channel Shewanella sp. (strain ANA-3)
Q3K6I0 3.04e-58 179 63 0 135 3 mscL Large-conductance mechanosensitive channel Pseudomonas fluorescens (strain Pf0-1)
A4YAR8 1.07e-57 178 60 0 135 3 mscL Large-conductance mechanosensitive channel Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A9L4L5 2.38e-57 177 60 0 135 3 mscL Large-conductance mechanosensitive channel Shewanella baltica (strain OS195)
A6WT30 2.38e-57 177 60 0 135 3 mscL Large-conductance mechanosensitive channel Shewanella baltica (strain OS185)
A3CZU7 2.38e-57 177 60 0 135 3 mscL Large-conductance mechanosensitive channel Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8ECI1 2.38e-57 177 60 0 135 3 mscL Large-conductance mechanosensitive channel Shewanella baltica (strain OS223)
A1RFK8 4.03e-57 177 60 0 135 3 mscL Large-conductance mechanosensitive channel Shewanella sp. (strain W3-18-1)
A6VKX7 4.39e-57 176 65 1 132 3 mscL Large-conductance mechanosensitive channel Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q8EJE5 8.31e-57 176 62 0 135 3 mscL Large-conductance mechanosensitive channel Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
C3LVM7 9.79e-57 176 61 0 134 3 mscL Large-conductance mechanosensitive channel Vibrio cholerae serotype O1 (strain M66-2)
Q9KLX9 9.79e-57 176 61 0 134 3 mscL Large-conductance mechanosensitive channel Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F037 9.79e-57 176 61 0 134 3 mscL Large-conductance mechanosensitive channel Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
C3K2E3 2.82e-56 174 62 0 134 3 mscL Large-conductance mechanosensitive channel Pseudomonas fluorescens (strain SBW25)
A0KNB2 4.9e-56 174 61 1 134 3 mscL Large-conductance mechanosensitive channel Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q4K5Q6 5.77e-56 174 60 0 135 3 mscL Large-conductance mechanosensitive channel Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
O68286 8.66e-56 173 63 2 136 3 mscL Large-conductance mechanosensitive channel Pseudomonas fluorescens
Q65QF7 8.92e-56 173 64 1 132 3 mscL Large-conductance mechanosensitive channel Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
B0UWZ1 4.81e-55 171 62 1 132 3 mscL Large-conductance mechanosensitive channel Histophilus somni (strain 2336)
Q0I185 4.81e-55 171 62 1 132 3 mscL Large-conductance mechanosensitive channel Histophilus somni (strain 129Pt)
B1J2X0 9.19e-55 171 64 0 135 3 mscL Large-conductance mechanosensitive channel Pseudomonas putida (strain W619)
A4SJT9 1.4e-54 170 58 1 134 3 mscL Large-conductance mechanosensitive channel Aeromonas salmonicida (strain A449)
B4S9H4 3.52e-54 169 60 0 134 3 mscL Large-conductance mechanosensitive channel Prosthecochloris aestuarii (strain DSM 271 / SK 413)
B3EL80 1.75e-51 162 54 1 134 3 mscL Large-conductance mechanosensitive channel Chlorobium phaeobacteroides (strain BS1)
A7I339 3.38e-51 161 56 0 132 3 mscL Large-conductance mechanosensitive channel Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
A7GXI2 1.07e-49 158 57 1 133 3 mscL Large-conductance mechanosensitive channel Campylobacter curvus (strain 525.92)
Q7VKA0 2.14e-49 157 58 2 134 3 mscL Large-conductance mechanosensitive channel Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q2NQQ0 5.68e-49 156 72 0 101 3 mscL Large-conductance mechanosensitive channel Sodalis glossinidius (strain morsitans)
A5UEB0 1.87e-47 152 65 1 133 3 mscL Large-conductance mechanosensitive channel Haemophilus influenzae (strain PittEE)
P44789 1.9e-47 152 64 1 133 3 mscL Large-conductance mechanosensitive channel Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UH89 3.2e-47 151 63 1 133 3 mscL Large-conductance mechanosensitive channel Haemophilus influenzae (strain PittGG)
Q4QMW0 3.2e-47 151 63 1 133 3 mscL Large-conductance mechanosensitive channel Haemophilus influenzae (strain 86-028NP)
A6L685 2.82e-46 149 58 2 138 3 mscL Large-conductance mechanosensitive channel Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
B3H2I9 1.94e-45 147 59 1 132 3 mscL Large-conductance mechanosensitive channel Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N2P0 1.94e-45 147 59 1 132 3 mscL Large-conductance mechanosensitive channel Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q64XQ8 2.65e-45 147 60 2 141 3 mscL Large-conductance mechanosensitive channel Bacteroides fragilis (strain YCH46)
Q5LGV7 2.65e-45 147 60 2 141 3 mscL Large-conductance mechanosensitive channel Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
A6L898 1.26e-44 145 57 2 135 3 mscL Large-conductance mechanosensitive channel Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
Q9X722 1.25e-43 142 52 3 133 3 mscL Large-conductance mechanosensitive channel Hathewaya histolytica
Q1H3M0 4.69e-43 141 55 2 140 3 mscL Large-conductance mechanosensitive channel Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q89ZV7 1.1e-42 140 52 3 144 3 mscL Large-conductance mechanosensitive channel Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
B7GLN3 1.89e-42 139 53 2 134 3 mscL Large-conductance mechanosensitive channel Anoxybacillus flavithermus (strain DSM 21510 / WK1)
Q3SRA3 2.03e-42 139 52 1 136 3 mscL Large-conductance mechanosensitive channel Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
B6JGA5 3.11e-42 139 50 2 137 3 mscL Large-conductance mechanosensitive channel Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
Q3ANR9 5.87e-42 139 53 3 134 3 mscL Large-conductance mechanosensitive channel Chlorobium chlorochromatii (strain CaD3)
A8MGZ0 6.96e-42 138 56 2 130 3 mscL Large-conductance mechanosensitive channel Alkaliphilus oremlandii (strain OhILAs)
B4RCK7 9.68e-42 138 51 2 137 3 mscL Large-conductance mechanosensitive channel Phenylobacterium zucineum (strain HLK1)
A7ZCB7 9.78e-42 137 57 1 135 3 mscL Large-conductance mechanosensitive channel Campylobacter concisus (strain 13826)
Q8P626 2.04e-41 137 50 2 139 3 mscL Large-conductance mechanosensitive channel Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UXZ0 2.04e-41 137 50 2 139 3 mscL Large-conductance mechanosensitive channel Xanthomonas campestris pv. campestris (strain 8004)
C5DA22 2.94e-41 136 53 3 134 3 mscL Large-conductance mechanosensitive channel Geobacillus sp. (strain WCH70)
B0RPI5 3.12e-41 137 50 2 139 3 mscL Large-conductance mechanosensitive channel Xanthomonas campestris pv. campestris (strain B100)
Q2JLN5 3.24e-41 136 51 3 136 3 mscL Large-conductance mechanosensitive channel Synechococcus sp. (strain JA-2-3B'a(2-13))
Q214K6 3.52e-41 136 52 3 139 3 mscL Large-conductance mechanosensitive channel Rhodopseudomonas palustris (strain BisB18)
Q2JSN8 3.74e-41 136 50 2 134 3 mscL Large-conductance mechanosensitive channel Synechococcus sp. (strain JA-3-3Ab)
A4IMP7 4.27e-41 136 52 2 133 3 mscL Large-conductance mechanosensitive channel Geobacillus thermodenitrificans (strain NG80-2)
Q8RFE0 1.12e-40 135 50 0 132 3 mscL Large-conductance mechanosensitive channel Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
A1KC82 1.2e-40 135 54 2 141 3 mscL Large-conductance mechanosensitive channel Azoarcus sp. (strain BH72)
Q5P4W4 1.3e-40 135 52 2 139 3 mscL Large-conductance mechanosensitive channel Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q3BQ08 3.97e-40 134 48 2 139 3 mscL Large-conductance mechanosensitive channel Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8PHE9 3.97e-40 134 48 2 139 3 mscL Large-conductance mechanosensitive channel Xanthomonas axonopodis pv. citri (strain 306)
B4STT2 5.65e-40 133 56 2 137 3 mscL Large-conductance mechanosensitive channel Stenotrophomonas maltophilia (strain R551-3)
Q5GXD6 1.21e-39 132 48 2 139 3 mscL Large-conductance mechanosensitive channel Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SWL6 1.21e-39 132 48 2 139 3 mscL Large-conductance mechanosensitive channel Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q5L081 1.38e-39 132 51 2 133 3 mscL Large-conductance mechanosensitive channel Geobacillus kaustophilus (strain HTA426)
Q2P0I7 2.59e-39 132 48 2 139 3 mscL Large-conductance mechanosensitive channel Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
B2FSD7 3.07e-39 131 55 2 137 3 mscL Large-conductance mechanosensitive channel Stenotrophomonas maltophilia (strain K279a)
Q5WTR2 6.3e-39 130 51 3 135 3 mscL Large-conductance mechanosensitive channel Legionella pneumophila (strain Lens)
B0BRR8 8.23e-39 130 54 1 132 3 mscL Large-conductance mechanosensitive channel Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
A5IEQ9 9.86e-39 130 50 2 135 3 mscL Large-conductance mechanosensitive channel Legionella pneumophila (strain Corby)
Q136W9 1.43e-38 130 48 1 136 3 mscL Large-conductance mechanosensitive channel Rhodopseudomonas palustris (strain BisB5)
Q5X1Y7 2.21e-38 129 51 3 135 3 mscL Large-conductance mechanosensitive channel Legionella pneumophila (strain Paris)
Q7MUZ1 2.31e-38 129 54 2 137 3 mscL Large-conductance mechanosensitive channel Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
B2RJU3 2.31e-38 129 54 2 137 3 mscL Large-conductance mechanosensitive channel Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)
Q71XV0 2.9e-38 129 50 2 130 3 mscL Large-conductance mechanosensitive channel Listeria monocytogenes serotype 4b (strain F2365)
C1KX17 2.9e-38 129 50 2 130 3 mscL Large-conductance mechanosensitive channel Listeria monocytogenes serotype 4b (strain CLIP80459)
Q5ZSH7 3.43e-38 128 51 3 135 3 mscL Large-conductance mechanosensitive channel Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
B4SGK3 5.56e-38 129 51 2 128 3 mscL Large-conductance mechanosensitive channel Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
C4LE79 6.42e-38 128 51 1 124 3 mscL Large-conductance mechanosensitive channel Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q929V3 8.18e-38 127 50 2 130 3 mscL Large-conductance mechanosensitive channel Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
B3ECJ4 9.31e-38 128 56 1 111 3 mscL Large-conductance mechanosensitive channel Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
Q6N6D0 1.14e-37 128 45 1 137 3 mscL Large-conductance mechanosensitive channel Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
A0RJR6 1.31e-37 127 52 2 130 3 mscL Large-conductance mechanosensitive channel Bacillus thuringiensis (strain Al Hakam)
A4YWD8 1.69e-37 127 52 1 136 3 mscL Large-conductance mechanosensitive channel Bradyrhizobium sp. (strain ORS 278)
A7GTU7 2e-37 127 51 3 132 3 mscL Large-conductance mechanosensitive channel Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
B0V4Z4 2.3e-37 127 48 3 143 3 mscL Large-conductance mechanosensitive channel Acinetobacter baumannii (strain AYE)
A3M8J6 2.3e-37 127 48 3 143 3 mscL Large-conductance mechanosensitive channel Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0VRV0 2.3e-37 127 48 3 143 3 mscL Large-conductance mechanosensitive channel Acinetobacter baumannii (strain SDF)
B2HYF5 2.3e-37 127 48 3 143 3 mscL Large-conductance mechanosensitive channel Acinetobacter baumannii (strain ACICU)
B7I868 2.3e-37 127 48 3 143 3 mscL Large-conductance mechanosensitive channel Acinetobacter baumannii (strain AB0057)
B7GWU1 2.3e-37 127 48 3 143 3 mscL Large-conductance mechanosensitive channel Acinetobacter baumannii (strain AB307-0294)
Q6HCK7 2.55e-37 126 51 2 130 3 mscL Large-conductance mechanosensitive channel Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q633B8 2.55e-37 126 51 2 130 3 mscL Large-conductance mechanosensitive channel Bacillus cereus (strain ZK / E33L)
C1EV23 2.55e-37 126 51 2 130 3 mscL Large-conductance mechanosensitive channel Bacillus cereus (strain 03BB102)
Q81KR6 2.55e-37 126 51 2 130 3 mscL Large-conductance mechanosensitive channel Bacillus anthracis
C3L9Y0 2.55e-37 126 51 2 130 3 mscL Large-conductance mechanosensitive channel Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3PBD7 2.55e-37 126 51 2 130 3 mscL Large-conductance mechanosensitive channel Bacillus anthracis (strain A0248)
Q3B3W2 3.7e-37 127 50 1 122 3 mscL Large-conductance mechanosensitive channel Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
Q2IWV4 4.29e-37 126 50 1 138 3 mscL Large-conductance mechanosensitive channel Rhodopseudomonas palustris (strain HaA2)
A4SEF1 5.23e-37 126 46 2 130 3 mscL Large-conductance mechanosensitive channel Chlorobium phaeovibrioides (strain DSM 265 / 1930)
B9J176 6.71e-37 125 51 3 133 3 mscL Large-conductance mechanosensitive channel Bacillus cereus (strain Q1)
B7HSK8 6.71e-37 125 51 3 133 3 mscL Large-conductance mechanosensitive channel Bacillus cereus (strain AH187)
B7JS48 6.73e-37 125 50 2 130 3 mscL Large-conductance mechanosensitive channel Bacillus cereus (strain AH820)
Q1QL44 9.96e-37 125 48 1 137 3 mscL Large-conductance mechanosensitive channel Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q749E9 1.25e-36 125 53 2 118 3 mscL Large-conductance mechanosensitive channel Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q816Z0 1.34e-36 124 53 4 132 3 mscL Large-conductance mechanosensitive channel Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B7H732 1.34e-36 124 53 4 132 3 mscL Large-conductance mechanosensitive channel Bacillus cereus (strain B4264)
Q72Z61 1.63e-36 124 53 4 132 3 mscL Large-conductance mechanosensitive channel Bacillus cereus (strain ATCC 10987 / NRS 248)
Q0AWD5 2.04e-36 125 49 2 126 3 mscL Large-conductance mechanosensitive channel Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
A9VKI1 2.13e-36 124 51 2 131 3 mscL Large-conductance mechanosensitive channel Bacillus mycoides (strain KBAB4)
B1HRA8 2.14e-36 124 48 3 132 3 mscL Large-conductance mechanosensitive channel Lysinibacillus sphaericus (strain C3-41)
Q89K46 2.73e-36 124 48 1 137 3 mscL Large-conductance mechanosensitive channel Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
C4KYQ8 5.89e-36 123 48 1 130 3 mscL Large-conductance mechanosensitive channel Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
A8FI71 7.29e-36 122 54 2 132 3 mscL Large-conductance mechanosensitive channel Bacillus pumilus (strain SAFR-032)
B9EBV2 1.32e-35 122 51 2 133 3 mscL Large-conductance mechanosensitive channel Macrococcus caseolyticus (strain JCSC5402)
A1BFW8 1.56e-35 122 47 2 126 3 mscL Large-conductance mechanosensitive channel Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
B0U1E0 1.73e-35 122 51 2 137 3 mscL Large-conductance mechanosensitive channel Xylella fastidiosa (strain M12)
Q9PHA5 2.01e-35 122 52 2 137 3 mscL Large-conductance mechanosensitive channel Xylella fastidiosa (strain 9a5c)
Q898L6 2.02e-35 122 46 2 131 3 mscL Large-conductance mechanosensitive channel Clostridium tetani (strain Massachusetts / E88)
B7IKT7 2.26e-35 121 52 4 132 3 mscL Large-conductance mechanosensitive channel Bacillus cereus (strain G9842)
C0Z921 2.9e-35 122 44 2 146 3 mscL Large-conductance mechanosensitive channel Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
Q6G4F8 3.05e-35 121 44 3 136 3 mscL Large-conductance mechanosensitive channel Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q1LIC3 4.27e-35 121 47 2 141 3 mscL Large-conductance mechanosensitive channel Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q39SN1 4.59e-35 121 46 1 124 3 mscL Large-conductance mechanosensitive channel Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
B3QN57 5.46e-35 121 48 2 130 3 mscL Large-conductance mechanosensitive channel Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
B8H6A4 6.36e-35 120 52 2 138 3 mscL Large-conductance mechanosensitive channel Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A2H6 6.36e-35 120 52 2 138 3 mscL Large-conductance mechanosensitive channel Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q2LUI9 6.69e-35 121 48 2 127 3 mscL Large-conductance mechanosensitive channel Syntrophus aciditrophicus (strain SB)
Q8CUT6 8.16e-35 120 47 2 132 3 mscL Large-conductance mechanosensitive channel Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q8G2K1 1.21e-34 120 43 2 138 3 mscL Large-conductance mechanosensitive channel Brucella suis biovar 1 (strain 1330)
B0CJU8 1.21e-34 120 43 2 138 3 mscL Large-conductance mechanosensitive channel Brucella suis (strain ATCC 23445 / NCTC 10510)
Q8YFB7 1.21e-34 120 43 2 138 3 mscL Large-conductance mechanosensitive channel Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RH35 1.21e-34 120 43 2 138 3 mscL Large-conductance mechanosensitive channel Brucella melitensis biotype 2 (strain ATCC 23457)
A9M8A1 1.21e-34 120 43 2 138 3 mscL Large-conductance mechanosensitive channel Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q57F40 1.21e-34 120 43 2 138 3 mscL Large-conductance mechanosensitive channel Brucella abortus biovar 1 (strain 9-941)
Q2YPJ2 1.21e-34 120 43 2 138 3 mscL Large-conductance mechanosensitive channel Brucella abortus (strain 2308)
B2S9G8 1.21e-34 120 43 2 138 3 mscL Large-conductance mechanosensitive channel Brucella abortus (strain S19)
A9IQ78 1.22e-34 120 44 3 135 3 mscL Large-conductance mechanosensitive channel Bartonella tribocorum (strain CIP 105476 / IBS 506)
A5VNQ9 1.27e-34 120 43 2 138 3 mscL Large-conductance mechanosensitive channel Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q87FA1 1.32e-34 119 51 2 137 3 mscL Large-conductance mechanosensitive channel Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I658 1.32e-34 119 51 2 137 3 mscL Large-conductance mechanosensitive channel Xylella fastidiosa (strain M23)
Q7NYB4 1.4e-34 120 50 1 118 3 mscL Large-conductance mechanosensitive channel Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q0SWK0 1.84e-34 120 47 2 125 3 mscL Large-conductance mechanosensitive channel Clostridium perfringens (strain SM101 / Type A)
B8DR67 2.18e-34 119 50 2 122 3 mscL Large-conductance mechanosensitive channel Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
B8GTM8 2.22e-34 119 61 1 134 3 mscL Large-conductance mechanosensitive channel Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
A3PMB5 2.32e-34 119 46 3 145 3 mscL Large-conductance mechanosensitive channel Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
A6WVY7 2.37e-34 119 44 3 136 3 mscL Large-conductance mechanosensitive channel Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q3IZY4 2.45e-34 119 46 3 145 3 mscL Large-conductance mechanosensitive channel Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q6G160 4e-34 118 42 3 136 3 mscL Large-conductance mechanosensitive channel Bartonella quintana (strain Toulouse)
B9M9E4 4.64e-34 119 50 3 123 3 mscL Large-conductance mechanosensitive channel Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
Q0TUQ9 7.35e-34 118 46 2 125 3 mscL Large-conductance mechanosensitive channel Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
A4WVB7 9.66e-34 118 47 3 146 3 mscL Large-conductance mechanosensitive channel Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Q6MRC6 1.15e-33 117 51 1 120 3 mscL Large-conductance mechanosensitive channel Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
C5CQL2 1.23e-33 117 51 2 146 3 mscL Large-conductance mechanosensitive channel Variovorax paradoxus (strain S110)
Q2SWU6 1.61e-33 117 44 2 146 3 mscL Large-conductance mechanosensitive channel Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63T62 1.61e-33 117 44 2 146 3 mscL Large-conductance mechanosensitive channel Burkholderia pseudomallei (strain K96243)
A3NAN4 1.61e-33 117 44 2 146 3 mscL Large-conductance mechanosensitive channel Burkholderia pseudomallei (strain 668)
Q3JR90 1.61e-33 117 44 2 146 3 mscL Large-conductance mechanosensitive channel Burkholderia pseudomallei (strain 1710b)
A3NWF4 1.61e-33 117 44 2 146 3 mscL Large-conductance mechanosensitive channel Burkholderia pseudomallei (strain 1106a)
A1V513 1.61e-33 117 44 2 146 3 mscL Large-conductance mechanosensitive channel Burkholderia mallei (strain SAVP1)
Q62JH4 1.61e-33 117 44 2 146 3 mscL Large-conductance mechanosensitive channel Burkholderia mallei (strain ATCC 23344)
A2SBC7 1.61e-33 117 44 2 146 3 mscL Large-conductance mechanosensitive channel Burkholderia mallei (strain NCTC 10229)
A3MKN7 1.61e-33 117 44 2 146 3 mscL Large-conductance mechanosensitive channel Burkholderia mallei (strain NCTC 10247)
Q11TN7 2.49e-33 116 47 3 143 3 mscL Large-conductance mechanosensitive channel Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
Q39FB0 3.28e-33 116 45 3 149 3 mscL Large-conductance mechanosensitive channel Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
B4EC31 3.28e-33 116 45 3 149 3 mscL Large-conductance mechanosensitive channel Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A1VK53 3.4e-33 116 44 2 143 3 mscL Large-conductance mechanosensitive channel Polaromonas naphthalenivorans (strain CJ2)
Q65E27 3.81e-33 115 49 2 130 3 mscL Large-conductance mechanosensitive channel Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
A1URL2 4.06e-33 116 43 3 141 3 mscL Large-conductance mechanosensitive channel Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
A7HR02 5.73e-33 115 48 2 140 3 mscL Large-conductance mechanosensitive channel Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
A4G9H5 7.27e-33 115 47 2 139 3 mscL Large-conductance mechanosensitive channel Herminiimonas arsenicoxydans
Q6FE93 7.41e-33 115 48 2 143 3 mscL Large-conductance mechanosensitive channel Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q1BHB3 7.58e-33 115 45 2 146 3 mscL Large-conductance mechanosensitive channel Burkholderia orbicola (strain AU 1054)
A0K875 7.58e-33 115 45 2 146 3 mscL Large-conductance mechanosensitive channel Burkholderia cenocepacia (strain HI2424)
Q0BEC9 9.02e-33 115 45 3 149 3 mscL Large-conductance mechanosensitive channel Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B1YS18 9.02e-33 115 45 3 149 3 mscL Large-conductance mechanosensitive channel Burkholderia ambifaria (strain MC40-6)
Q5FNB7 9.7e-33 115 47 1 139 3 mscL Large-conductance mechanosensitive channel Gluconobacter oxydans (strain 621H)
B1JTX9 1.02e-32 115 45 2 146 3 mscL Large-conductance mechanosensitive channel Burkholderia orbicola (strain MC0-3)
A1W457 1.76e-32 114 47 1 142 3 mscL Large-conductance mechanosensitive channel Acidovorax sp. (strain JS42)
B9MDX6 1.76e-32 114 47 1 142 3 mscL Large-conductance mechanosensitive channel Acidovorax ebreus (strain TPSY)
B1ZC68 1.9e-32 114 43 3 141 3 mscL Large-conductance mechanosensitive channel Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
Q98B79 2.54e-32 114 46 2 139 3 mscL3 Large-conductance mechanosensitive channel 3 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
A8YTR2 3.58e-32 113 45 2 130 3 mscL Large-conductance mechanosensitive channel Lactobacillus helveticus (strain DPC 4571)
Q98DG5 6.63e-32 113 46 2 139 3 mscL2 Large-conductance mechanosensitive channel 2 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
B2UDT8 6.72e-32 113 42 2 143 3 mscL Large-conductance mechanosensitive channel Ralstonia pickettii (strain 12J)
A9BX57 6.87e-32 113 46 1 142 3 mscL Large-conductance mechanosensitive channel Delftia acidovorans (strain DSM 14801 / SPH-1)
A0AKH0 9.89e-32 112 50 2 130 3 mscL Large-conductance mechanosensitive channel Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
B8G6C2 1.17e-31 112 46 4 139 3 mscL Large-conductance mechanosensitive channel Chloroflexus aggregans (strain MD-66 / DSM 9485)
Q74HV9 1.29e-31 112 46 3 132 3 mscL Large-conductance mechanosensitive channel Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q98DH7 1.51e-31 112 48 2 138 3 mscL1 Large-conductance mechanosensitive channel 1 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q24Y14 1.53e-31 112 52 1 107 3 mscL Large-conductance mechanosensitive channel Desulfitobacterium hafniense (strain Y51)
B8FTI4 1.53e-31 112 52 1 107 3 mscL Large-conductance mechanosensitive channel Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
Q03SF6 1.55e-31 111 48 4 132 3 mscL Large-conductance mechanosensitive channel Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
B4UD86 1.55e-31 112 44 2 142 3 mscL Large-conductance mechanosensitive channel Anaeromyxobacter sp. (strain K)
A1B4B3 1.64e-31 112 46 2 141 3 mscL Large-conductance mechanosensitive channel Paracoccus denitrificans (strain Pd 1222)
A6T365 2.49e-31 111 46 1 139 3 mscL Large-conductance mechanosensitive channel Janthinobacterium sp. (strain Marseille)
B8J6V0 2.98e-31 111 44 2 142 3 mscL Large-conductance mechanosensitive channel Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
A9W5W6 3.2e-31 111 42 1 135 3 mscL Large-conductance mechanosensitive channel Methylorubrum extorquens (strain PA1)
B7KPQ5 3.2e-31 111 42 1 135 3 mscL Large-conductance mechanosensitive channel Methylorubrum extorquens (strain CM4 / NCIMB 13688)
A9WJI9 4.33e-31 110 46 3 139 3 mscL Large-conductance mechanosensitive channel Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
B9J924 4.44e-31 111 44 3 141 3 mscL Large-conductance mechanosensitive channel Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
Q8UHY0 4.47e-31 111 43 3 141 3 mscL Large-conductance mechanosensitive channel Agrobacterium fabrum (strain C58 / ATCC 33970)
Q3ZYR8 4.67e-31 111 44 4 137 3 mscL Large-conductance mechanosensitive channel Dehalococcoides mccartyi (strain CBDB1)
Q2G9Z8 4.91e-31 111 41 2 147 3 mscL Large-conductance mechanosensitive channel Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
B1M0R9 5.33e-31 110 42 3 138 3 mscL Large-conductance mechanosensitive channel Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
A5FPV4 7.96e-31 110 46 3 126 3 mscL Large-conductance mechanosensitive channel Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1)
C1DBZ0 8.67e-31 110 48 1 113 3 mscL Large-conductance mechanosensitive channel Laribacter hongkongensis (strain HLHK9)
A2SE21 1.33e-30 109 44 2 139 3 mscL Large-conductance mechanosensitive channel Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
B9DP78 1.74e-30 109 45 2 130 3 mscL Large-conductance mechanosensitive channel Staphylococcus carnosus (strain TM300)
Q8Y5J6 1.83e-30 108 49 2 130 3 mscL Large-conductance mechanosensitive channel Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
B8DH65 1.83e-30 108 49 2 130 3 mscL Large-conductance mechanosensitive channel Listeria monocytogenes serotype 4a (strain HCC23)
Q041C3 1.95e-30 108 45 2 132 3 mscL Large-conductance mechanosensitive channel Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
A9AIS5 3.8e-30 108 44 2 146 3 mscL Large-conductance mechanosensitive channel Burkholderia multivorans (strain ATCC 17616 / 249)
P68806 4.57e-30 107 44 3 131 1 mscL Large-conductance mechanosensitive channel Staphylococcus aureus (strain MW2)
Q6G9L1 4.57e-30 107 44 3 131 1 mscL Large-conductance mechanosensitive channel Staphylococcus aureus (strain MSSA476)
Q6GH57 4.57e-30 107 44 3 131 3 mscL Large-conductance mechanosensitive channel Staphylococcus aureus (strain MRSA252)
P68804 4.57e-30 107 44 3 131 3 mscL Large-conductance mechanosensitive channel Staphylococcus aureus (strain N315)
P68803 4.57e-30 107 44 3 131 3 mscL Large-conductance mechanosensitive channel Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QGQ0 4.57e-30 107 44 3 131 3 mscL Large-conductance mechanosensitive channel Staphylococcus aureus (strain Newman)
Q5HG71 4.57e-30 107 44 3 131 3 mscL Large-conductance mechanosensitive channel Staphylococcus aureus (strain COL)
Q2YXW9 4.57e-30 107 44 3 131 3 mscL Large-conductance mechanosensitive channel Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5ISN0 4.57e-30 107 44 3 131 3 mscL Large-conductance mechanosensitive channel Staphylococcus aureus (strain JH9)
P68805 4.57e-30 107 44 3 131 1 mscL Large-conductance mechanosensitive channel Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH87 4.57e-30 107 44 3 131 3 mscL Large-conductance mechanosensitive channel Staphylococcus aureus (strain USA300)
A6U1G8 4.57e-30 107 44 3 131 3 mscL Large-conductance mechanosensitive channel Staphylococcus aureus (strain JH1)
A7X204 4.57e-30 107 44 3 131 3 mscL Large-conductance mechanosensitive channel Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q46WM9 2.15e-29 107 48 2 143 3 mscL Large-conductance mechanosensitive channel Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q7W2W9 3.93e-29 106 44 2 144 3 mscL Large-conductance mechanosensitive channel Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
A1TTF7 3.94e-29 106 45 2 143 3 mscL Large-conductance mechanosensitive channel Paracidovorax citrulli (strain AAC00-1)
Q7WDW9 4.2e-29 106 44 2 144 3 mscL Large-conductance mechanosensitive channel Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q0C5R9 5.8e-29 105 44 2 136 3 mscL Large-conductance mechanosensitive channel Hyphomonas neptunium (strain ATCC 15444)
A9HW97 6.13e-29 105 46 2 143 3 mscL Large-conductance mechanosensitive channel Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
B2ID03 6.27e-29 105 44 4 138 3 mscL Large-conductance mechanosensitive channel Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
B8EJ45 9.08e-29 105 43 4 140 3 mscL Large-conductance mechanosensitive channel Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
Q16BG3 9.75e-29 105 42 2 140 3 mscL Large-conductance mechanosensitive channel Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
A4JF27 1.17e-28 105 43 3 149 3 mscL Large-conductance mechanosensitive channel Burkholderia vietnamiensis (strain G4 / LMG 22486)
B1YKK2 1.29e-28 104 48 3 132 3 mscL Large-conductance mechanosensitive channel Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
B3EA78 1.33e-28 105 46 1 115 3 mscL Large-conductance mechanosensitive channel Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
Q7W079 1.67e-28 104 44 2 144 3 mscL Large-conductance mechanosensitive channel Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
B2G5U0 1.75e-28 103 42 2 130 3 mscL Large-conductance mechanosensitive channel Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VIB3 1.75e-28 103 42 2 130 3 mscL Large-conductance mechanosensitive channel Limosilactobacillus reuteri (strain DSM 20016)
Q8XVA1 1.76e-28 104 37 2 145 3 mscL Large-conductance mechanosensitive channel Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q1GUG3 2.3e-28 104 42 3 141 3 mscL Large-conductance mechanosensitive channel Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
B2GEU1 2.87e-28 103 43 3 132 3 mscL Large-conductance mechanosensitive channel Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
Q0K6A4 2.91e-28 103 44 2 143 3 mscL Large-conductance mechanosensitive channel Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q4FUU9 3.78e-28 103 42 3 146 3 mscL Large-conductance mechanosensitive channel Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
A5FKC3 6.9e-28 102 45 3 133 3 mscL Large-conductance mechanosensitive channel Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / BCRC 14874 / CCUG 350202 / NBRC 14942 / NCIMB 11054 / UW101)
Q2KCQ1 7.25e-28 103 43 2 141 3 mscL Large-conductance mechanosensitive channel Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
C0QYW6 8.45e-28 103 44 1 112 3 mscL Large-conductance mechanosensitive channel Brachyspira hyodysenteriae (strain ATCC 49526 / WA1)
Q47AR9 1.14e-27 102 43 1 141 3 mscL Large-conductance mechanosensitive channel Dechloromonas aromatica (strain RCB)
P53380 1.18e-27 102 48 2 125 3 mscL Large-conductance mechanosensitive channel Clostridium perfringens (strain 13 / Type A)
Q1WVR1 1.3e-27 101 45 3 133 3 mscL Large-conductance mechanosensitive channel Ligilactobacillus salivarius (strain UCC118)
B2T3W8 1.63e-27 102 43 1 146 3 mscL Large-conductance mechanosensitive channel Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q8KD14 2.04e-27 102 48 2 130 3 mscL Large-conductance mechanosensitive channel Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q13Z35 2.14e-27 102 43 2 146 3 mscL Large-conductance mechanosensitive channel Paraburkholderia xenovorans (strain LB400)
B5ZPK8 2.58e-27 101 43 2 141 3 mscL Large-conductance mechanosensitive channel Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q4L656 3.97e-27 100 43 3 130 3 mscL Large-conductance mechanosensitive channel Staphylococcus haemolyticus (strain JCSC1435)
B3PNR8 3.99e-27 101 43 2 141 3 mscL Large-conductance mechanosensitive channel Rhizobium etli (strain CIAT 652)
B0T274 8.21e-27 100 51 2 137 3 mscL Large-conductance mechanosensitive channel Caulobacter sp. (strain K31)
Q88X97 9.29e-27 99 44 2 132 3 mscL Large-conductance mechanosensitive channel Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
A8LLI0 1.12e-26 99 40 2 133 3 mscL Large-conductance mechanosensitive channel Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
Q9CDW0 1.53e-26 99 42 2 130 3 mscL Large-conductance mechanosensitive channel Lactococcus lactis subsp. lactis (strain IL1403)
B1Y2I5 1.56e-26 99 45 2 140 3 mscL Large-conductance mechanosensitive channel Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
Q1MLQ8 3e-26 99 42 2 141 3 mscL Large-conductance mechanosensitive channel Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q034S0 3.12e-26 98 38 3 134 3 mscL Large-conductance mechanosensitive channel Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
B3WAS8 3.12e-26 98 38 3 134 3 mscL Large-conductance mechanosensitive channel Lacticaseibacillus casei (strain BL23)
B2JGJ7 7.55e-26 98 40 1 146 3 mscL Large-conductance mechanosensitive channel Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q5FLW0 1.02e-25 97 40 2 130 3 mscL Large-conductance mechanosensitive channel Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q02W23 1.25e-25 96 41 2 129 3 mscL Large-conductance mechanosensitive channel Lactococcus lactis subsp. cremoris (strain SK11)
A2RNQ7 1.25e-25 96 41 2 129 3 mscL Large-conductance mechanosensitive channel Lactococcus lactis subsp. cremoris (strain MG1363)
Q1QDU6 1.45e-25 97 41 3 149 3 mscL Large-conductance mechanosensitive channel Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
C3MFT5 3.67e-25 95 41 4 141 3 mscL Large-conductance mechanosensitive channel Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q92S72 4.97e-25 95 42 4 141 3 mscL Large-conductance mechanosensitive channel Rhizobium meliloti (strain 1021)
A6M387 9.81e-25 95 45 5 133 3 mscL Large-conductance mechanosensitive channel Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
Q5LMR7 1.3e-24 94 42 2 142 3 mscL Large-conductance mechanosensitive channel Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q03YJ0 1.74e-24 94 40 4 135 3 mscL Large-conductance mechanosensitive channel Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
A5WCE5 1.76e-24 94 41 2 143 3 mscL Large-conductance mechanosensitive channel Psychrobacter sp. (strain PRwf-1)
A9B815 1.86e-24 94 43 4 130 3 mscL Large-conductance mechanosensitive channel Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785 / 114-95)
A6U5U5 2.19e-24 94 42 3 140 3 mscL Large-conductance mechanosensitive channel Sinorhizobium medicae (strain WSM419)
A1APN2 2.23e-24 94 50 2 110 3 mscL Large-conductance mechanosensitive channel Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
B1MZU9 2.27e-24 93 40 4 135 3 mscL Large-conductance mechanosensitive channel Leuconostoc citreum (strain KM20)
Q49XE2 3.37e-24 92 45 2 131 3 mscL Large-conductance mechanosensitive channel Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q03D91 4.85e-24 93 45 3 128 3 mscL Large-conductance mechanosensitive channel Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
Q3SG48 5.49e-24 93 37 3 147 3 mscL Large-conductance mechanosensitive channel Thiobacillus denitrificans (strain ATCC 25259)
A9WMF7 2.3e-23 91 44 4 136 3 mscL Large-conductance mechanosensitive channel Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235)
Q67PL7 2.79e-23 91 45 1 107 3 mscL Large-conductance mechanosensitive channel Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q38V39 3.9e-23 90 41 2 135 3 mscL Large-conductance mechanosensitive channel Latilactobacillus sakei subsp. sakei (strain 23K)
A7Z9K9 3.92e-23 90 50 2 130 3 mscL Large-conductance mechanosensitive channel Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
A5VBY5 4.32e-23 90 37 3 143 3 mscL Large-conductance mechanosensitive channel Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
Q5NNP2 2.2e-22 89 37 4 154 3 mscL Large-conductance mechanosensitive channel Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q5N075 2.47e-22 88 38 3 126 3 mscL Large-conductance mechanosensitive channel Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q31LP8 2.47e-22 88 38 3 126 3 mscL Large-conductance mechanosensitive channel Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
P94585 2.91e-21 85 52 2 132 3 mscL Large-conductance mechanosensitive channel Bacillus subtilis (strain 168)
Q04FK1 1.91e-20 83 38 4 133 3 mscL Large-conductance mechanosensitive channel Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
A6GYI6 1.41e-18 79 39 2 139 3 mscL Large-conductance mechanosensitive channel Flavobacterium psychrophilum (strain ATCC 49511 / DSM 21280 / CIP 103535 / JIP02/86)
Q8CPC4 2.09e-17 75 41 3 129 3 mscL Large-conductance mechanosensitive channel Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HPJ2 2.09e-17 75 41 3 129 3 mscL Large-conductance mechanosensitive channel Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
A5UVR8 3.91e-17 75 43 4 130 3 mscL Large-conductance mechanosensitive channel Roseiflexus sp. (strain RS-1)
Q82ZB4 8.06e-17 74 37 3 143 3 mscL Large-conductance mechanosensitive channel Enterococcus faecalis (strain ATCC 700802 / V583)
A0PWB0 8.69e-14 67 33 3 133 3 mscL Large-conductance mechanosensitive channel Mycobacterium ulcerans (strain Agy99)
B2HEA6 8.69e-14 67 33 3 133 3 mscL Large-conductance mechanosensitive channel Mycobacterium marinum (strain ATCC BAA-535 / M)
C1ALX4 2.69e-13 65 34 4 133 3 mscL Large-conductance mechanosensitive channel Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KHC1 2.69e-13 65 34 4 133 3 mscL Large-conductance mechanosensitive channel Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P9WJN5 3.19e-13 65 36 4 133 1 mscL Large-conductance mechanosensitive channel Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WJN4 3.19e-13 65 36 4 133 3 mscL Large-conductance mechanosensitive channel Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U127 3.19e-13 65 36 4 133 3 mscL Large-conductance mechanosensitive channel Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
P0A5K9 3.19e-13 65 36 4 133 3 mscL Large-conductance mechanosensitive channel Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P73553 1.29e-12 63 34 4 123 3 mscL Large-conductance mechanosensitive channel Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q9Z5G4 1.26e-10 58 32 5 134 3 mscL Large-conductance mechanosensitive channel Mycobacterium leprae (strain TN)
B8ZU13 1.26e-10 58 32 5 134 3 mscL Large-conductance mechanosensitive channel Mycobacterium leprae (strain Br4923)
A0A097ZPE6 9.19e-08 51 30 3 101 3 andL Anditomin synthesis protein L Emericella variicolor

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS19065
Feature type CDS
Gene mscL
Product large-conductance mechanosensitive channel protein MscL
Location 21470 - 21877 (strand: -1)
Length 408 (nucleotides) / 135 (amino acids)

Contig

Accession term accessions NZ_VXKB01000011 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 30728 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2370
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01741 Large-conductance mechanosensitive channel, MscL

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1970 Cell wall/membrane/envelope biogenesis (M) M Large-conductance mechanosensitive channel

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03282 large conductance mechanosensitive channel - -

Protein Sequence

MSFIKEFREFAMRGNVVDMAVGIIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFTVVLREASGSAPAVLLNYGVFLQTVFDFVIVAFAIFIAIKMLNKLRREQAEVPAEPEAPPVEQQLLTEIRDLLKEQNK

Flanking regions ( +/- flanking 50bp)

TCTTATACTCGAAGATGACAACTTGTTAACATTTAGGTAAGGGATGAGCTATGAGCTTCATAAAAGAGTTTCGTGAATTTGCTATGCGCGGAAACGTCGTCGATATGGCCGTCGGTATCATTATCGGTGCGGCATTCGGGAAAATCGTTTCCTCGTTAGTTGCCGATATCATTATGCCACCACTGGGATTACTTATCGGGGGTATTGATTTCAAACAATTCACTGTCGTGCTACGCGAAGCAAGTGGTAGCGCCCCTGCAGTTTTACTTAATTATGGCGTCTTTCTGCAAACTGTATTTGATTTTGTCATCGTGGCATTTGCCATCTTTATTGCAATCAAAATGCTGAATAAATTACGTCGTGAGCAAGCTGAAGTACCTGCTGAACCAGAGGCACCTCCGGTTGAACAGCAGTTATTAACTGAAATCCGTGATTTATTAAAAGAACAAAATAAATAATAAACTAAAAGGCCGGTAGTAAAAGATCCTCGAATCGTTTACTACCGGCC