Homologs in group_2402

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_19260 FBDBKF_19260 82.5 Morganella morganii S1 bfd bacterioferritin-associated ferredoxin
EHELCC_19005 EHELCC_19005 82.5 Morganella morganii S2 bfd bacterioferritin-associated ferredoxin
NLDBIP_19020 NLDBIP_19020 82.5 Morganella morganii S4 bfd bacterioferritin-associated ferredoxin
LHKJJB_18875 LHKJJB_18875 82.5 Morganella morganii S3 bfd bacterioferritin-associated ferredoxin
HKOGLL_18610 HKOGLL_18610 82.5 Morganella morganii S5 bfd bacterioferritin-associated ferredoxin
PMI_RS16135 PMI_RS16135 46.0 Proteus mirabilis HI4320 bfd bacterioferritin-associated ferredoxin

Distribution of the homologs in the orthogroup group_2402

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2402

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AE56 7.07e-21 79 58 0 58 1 bfd Bacterioferritin-associated ferredoxin Escherichia coli (strain K12)
P0AE57 7.07e-21 79 58 0 58 3 bfd Bacterioferritin-associated ferredoxin Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
O68934 1.58e-20 79 58 0 53 3 bfd Bacterioferritin-associated ferredoxin Serratia marcescens
P0A1Z6 5.94e-20 77 64 0 53 3 bfd Bacterioferritin-associated ferredoxin Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1Z7 5.94e-20 77 64 0 53 3 bfd Bacterioferritin-associated ferredoxin Salmonella typhi
Q9HY80 4.16e-07 45 42 1 52 1 bfd Bacterioferritin-associated ferredoxin Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS18905
Feature type CDS
Gene bfd
Product bacterioferritin-associated ferredoxin
Location 5775 - 5966 (strand: 1)
Length 192 (nucleotides) / 63 (amino acids)

Contig

Accession term accessions NZ_VXKB01000011 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 30728 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2402
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04324 BFD-like [2Fe-2S] binding domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2906 Inorganic ion transport and metabolism (P) P Bacterioferritin-associated ferredoxin

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02192 bacterioferritin-associated ferredoxin - -

Protein Sequence

MYVCLCNAISDKAIRNVVRRHQVHSFGELRKIIPVGNECGKCIRHAKTVISEENMSVAVDQVA

Flanking regions ( +/- flanking 50bp)

TAATAATATTGATTATCATTTACTCTTTGTCTGAATCAGGAGGAATGATAATGTACGTGTGTCTGTGTAATGCCATCAGTGATAAAGCTATTCGTAATGTGGTGCGCCGGCATCAGGTTCATTCGTTTGGTGAATTACGTAAAATTATTCCTGTCGGTAATGAGTGTGGTAAGTGTATCCGCCATGCAAAAACCGTTATCTCGGAAGAGAACATGTCTGTAGCGGTTGACCAGGTCGCCTGAACCCCTCTGATTTATACCCGTCTGTTAATTTTTTGAACTGTATCGCCATT