Homologs in group_2448

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_20350 FBDBKF_20350 96.8 Morganella morganii S1 coaA type I pantothenate kinase
EHELCC_19690 EHELCC_19690 96.8 Morganella morganii S2 coaA type I pantothenate kinase
NLDBIP_19665 NLDBIP_19665 96.8 Morganella morganii S4 coaA type I pantothenate kinase
LHKJJB_19635 LHKJJB_19635 96.8 Morganella morganii S3 coaA type I pantothenate kinase
HKOGLL_19545 HKOGLL_19545 96.8 Morganella morganii S5 coaA type I pantothenate kinase
PMI_RS16100 PMI_RS16100 75.2 Proteus mirabilis HI4320 coaA type I pantothenate kinase

Distribution of the homologs in the orthogroup group_2448

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2448

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B1JJI8 0.0 509 76 1 313 3 coaA Pantothenate kinase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66FR1 0.0 509 76 1 313 3 coaA Pantothenate kinase Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TR20 0.0 509 76 1 313 3 coaA Pantothenate kinase Yersinia pestis (strain Pestoides F)
Q1CN90 0.0 509 76 1 313 3 coaA Pantothenate kinase Yersinia pestis bv. Antiqua (strain Nepal516)
A9R361 0.0 509 76 1 313 3 coaA Pantothenate kinase Yersinia pestis bv. Antiqua (strain Angola)
Q8ZAN6 0.0 509 76 1 313 3 coaA Pantothenate kinase Yersinia pestis
B2K103 0.0 509 76 1 313 3 coaA Pantothenate kinase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C2D3 0.0 509 76 1 313 3 coaA Pantothenate kinase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FNJ3 0.0 509 76 1 313 3 coaA Pantothenate kinase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q7MYE7 0.0 508 76 0 307 3 coaA Pantothenate kinase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
C6DHQ6 0.0 505 76 1 313 3 coaA Pantothenate kinase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
A8G8D9 0.0 504 75 1 313 3 coaA Pantothenate kinase Serratia proteamaculans (strain 568)
A1JIH1 4.08e-180 502 75 1 313 3 coaA Pantothenate kinase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q6DAN8 3.86e-179 500 75 1 313 3 coaA Pantothenate kinase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
B5XYG3 5.42e-179 499 74 1 313 1 coaA Pantothenate kinase Klebsiella pneumoniae (strain 342)
A7MQP3 7.05e-179 499 75 0 307 3 coaA Pantothenate kinase Cronobacter sakazakii (strain ATCC BAA-894)
A6TGN1 1.19e-178 499 74 1 313 3 coaA Pantothenate kinase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q9L9K3 1.64e-178 498 74 1 313 3 coaA Pantothenate kinase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
C0Q2Q8 1.64e-178 498 74 1 313 3 coaA Pantothenate kinase Salmonella paratyphi C (strain RKS4594)
A9N0I2 1.64e-178 498 74 1 313 3 coaA Pantothenate kinase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4TCR5 1.64e-178 498 74 1 313 3 coaA Pantothenate kinase Salmonella heidelberg (strain SL476)
B5QXR5 1.64e-178 498 74 1 313 3 coaA Pantothenate kinase Salmonella enteritidis PT4 (strain P125109)
B5FPY5 1.64e-178 498 74 1 313 3 coaA Pantothenate kinase Salmonella dublin (strain CT_02021853)
Q57H79 1.64e-178 498 74 1 313 3 coaA Pantothenate kinase Salmonella choleraesuis (strain SC-B67)
Q8Z318 1.79e-178 498 74 1 313 3 coaA Pantothenate kinase Salmonella typhi
B4TQI6 1.79e-178 498 74 1 313 3 coaA Pantothenate kinase Salmonella schwarzengrund (strain CVM19633)
B5BJP4 1.79e-178 498 74 1 313 3 coaA Pantothenate kinase Salmonella paratyphi A (strain AKU_12601)
Q5PK80 1.79e-178 498 74 1 313 3 coaA Pantothenate kinase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T0Y0 1.79e-178 498 74 1 313 3 coaA Pantothenate kinase Salmonella newport (strain SL254)
B5F0V8 1.79e-178 498 74 1 313 3 coaA Pantothenate kinase Salmonella agona (strain SL483)
B5RFK9 1.16e-177 496 74 1 313 3 coaA Pantothenate kinase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B2VG89 4.89e-177 494 75 1 316 3 coaA Pantothenate kinase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A8AKV0 6.01e-177 494 73 1 315 3 coaA Pantothenate kinase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q83PC5 1.63e-176 493 73 1 313 3 coaA Pantothenate kinase Shigella flexneri
B1LNT0 1.9e-176 493 73 1 313 3 coaA Pantothenate kinase Escherichia coli (strain SMS-3-5 / SECEC)
B7NFR9 1.9e-176 493 73 1 313 3 coaA Pantothenate kinase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q3YV06 2.76e-176 493 73 1 313 3 coaA Pantothenate kinase Shigella sonnei (strain Ss046)
B7LUM3 2.76e-176 493 73 1 313 3 coaA Pantothenate kinase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1R5X9 2.76e-176 493 73 1 313 3 coaA Pantothenate kinase Escherichia coli (strain UTI89 / UPEC)
P0A6I3 2.76e-176 493 73 1 313 1 coaA Pantothenate kinase Escherichia coli (strain K12)
P0A6I4 2.76e-176 493 73 1 313 3 coaA Pantothenate kinase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TA86 2.76e-176 493 73 1 313 3 coaA Pantothenate kinase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AIF2 2.76e-176 493 73 1 313 3 coaA Pantothenate kinase Escherichia coli O1:K1 / APEC
A8A778 2.76e-176 493 73 1 313 3 coaA Pantothenate kinase Escherichia coli O9:H4 (strain HS)
B1XBY1 2.76e-176 493 73 1 313 3 coaA Pantothenate kinase Escherichia coli (strain K12 / DH10B)
C5A0R9 2.76e-176 493 73 1 313 3 coaA Pantothenate kinase Escherichia coli (strain K12 / MC4100 / BW2952)
B7M726 2.76e-176 493 73 1 313 3 coaA Pantothenate kinase Escherichia coli O8 (strain IAI1)
B7MR65 2.76e-176 493 73 1 313 3 coaA Pantothenate kinase Escherichia coli O81 (strain ED1a)
B7NR61 2.76e-176 493 73 1 313 3 coaA Pantothenate kinase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
P0A6I5 2.76e-176 493 73 1 313 3 coaA Pantothenate kinase Escherichia coli O157:H7
B7LA72 2.76e-176 493 73 1 313 3 coaA Pantothenate kinase Escherichia coli (strain 55989 / EAEC)
B7MIW5 2.76e-176 493 73 1 313 3 coaA Pantothenate kinase Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UNV0 2.76e-176 493 73 1 313 3 coaA Pantothenate kinase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZUJ0 2.76e-176 493 73 1 313 3 coaA Pantothenate kinase Escherichia coli O139:H28 (strain E24377A / ETEC)
Q2NWS4 5.33e-176 492 74 0 307 3 coaA Pantothenate kinase Sodalis glossinidius (strain morsitans)
A4W599 6.01e-176 492 74 1 313 3 coaA Pantothenate kinase Enterobacter sp. (strain 638)
Q31U19 1.82e-175 491 73 1 313 3 coaA Pantothenate kinase Shigella boydii serotype 4 (strain Sb227)
B2TWG4 1.82e-175 491 73 1 313 3 coaA Pantothenate kinase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q32AF0 3.43e-175 490 73 1 313 3 coaA Pantothenate kinase Shigella dysenteriae serotype 1 (strain Sd197)
C4K6Z7 3.44e-171 480 73 0 305 3 coaA Pantothenate kinase Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
B3GYJ4 5.59e-157 444 64 0 314 3 coaA Pantothenate kinase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
B0BRA6 1.07e-156 443 64 0 314 3 coaA Pantothenate kinase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
A3N2G1 1.07e-156 443 64 0 314 3 coaA Pantothenate kinase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q7VPK9 6.98e-155 439 64 0 310 3 coaA Pantothenate kinase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
P57967 1.47e-149 425 66 1 308 3 coaA Pantothenate kinase Pasteurella multocida (strain Pm70)
Q9KV38 6.39e-147 418 64 1 311 3 coaA Pantothenate kinase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P44793 2.12e-146 417 63 1 307 3 coaA Pantothenate kinase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q65QG5 2.18e-144 412 62 1 310 3 coaA Pantothenate kinase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
A1T0P0 5.81e-143 409 61 0 305 3 coaA Pantothenate kinase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
A3Q967 1e-142 408 63 0 305 3 coaA Pantothenate kinase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q7MGQ9 3.34e-142 406 61 1 308 3 coaA Pantothenate kinase Vibrio vulnificus (strain YJ016)
A6VKH8 2.76e-141 404 62 1 307 3 coaA Pantothenate kinase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q0I1U8 3.01e-141 404 61 1 308 3 coaA Pantothenate kinase Histophilus somni (strain 129Pt)
B0UV22 5.5e-141 403 61 1 308 3 coaA Pantothenate kinase Histophilus somni (strain 2336)
Q8DD30 8.05e-141 402 60 1 308 3 coaA Pantothenate kinase Vibrio vulnificus (strain CMCP6)
B8CNB7 2.8e-138 396 62 0 305 3 coaA Pantothenate kinase Shewanella piezotolerans (strain WP3 / JCM 13877)
Q8EK83 1.31e-137 395 60 0 305 3 coaA Pantothenate kinase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A8GYW1 3.27e-137 394 62 0 305 3 coaA Pantothenate kinase Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
A0KRK9 9.99e-137 392 60 0 305 3 coaA Pantothenate kinase Shewanella sp. (strain ANA-3)
B0TM27 2.98e-136 391 61 0 305 3 coaA Pantothenate kinase Shewanella halifaxensis (strain HAW-EB4)
A1RE99 6.41e-136 390 60 0 305 3 coaA Pantothenate kinase Shewanella sp. (strain W3-18-1)
A4YBZ8 6.41e-136 390 60 0 305 3 coaA Pantothenate kinase Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q089R9 6.84e-136 390 60 0 305 3 coaA Pantothenate kinase Shewanella frigidimarina (strain NCIMB 400)
A9KW87 1.05e-135 390 60 0 305 3 coaA Pantothenate kinase Shewanella baltica (strain OS195)
A6WHR3 1.08e-135 390 60 0 305 3 coaA Pantothenate kinase Shewanella baltica (strain OS185)
A3DA75 1.08e-135 390 60 0 305 3 coaA Pantothenate kinase Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8EBM0 1.08e-135 390 60 0 305 3 coaA Pantothenate kinase Shewanella baltica (strain OS223)
A1S203 2.3e-135 389 60 0 305 3 coaA Pantothenate kinase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q0I0C1 3.03e-135 389 60 0 305 3 coaA Pantothenate kinase Shewanella sp. (strain MR-7)
Q0HNV3 3.09e-135 389 60 0 305 3 coaA Pantothenate kinase Shewanella sp. (strain MR-4)
A8G1G2 1.49e-134 387 60 0 305 3 coaA Pantothenate kinase Shewanella sediminis (strain HAW-EB3)
B1KMZ8 6.54e-134 385 60 0 305 3 coaA Pantothenate kinase Shewanella woodyi (strain ATCC 51908 / MS32)
Q12SX3 9.28e-133 382 58 0 305 3 coaA Pantothenate kinase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
C0Z7P4 7.14e-130 375 57 1 309 3 coaA Pantothenate kinase Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
A7HSG6 1.09e-125 365 55 2 314 3 coaA Pantothenate kinase Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
Q07UR1 8.05e-125 362 56 2 308 3 coaA Pantothenate kinase Rhodopseudomonas palustris (strain BisA53)
Q1D9X8 8.91e-123 357 53 1 316 3 coaA Pantothenate kinase Myxococcus xanthus (strain DK1622)
A5E8E3 1.01e-122 357 55 2 312 3 coaA Pantothenate kinase Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
Q2J338 1.74e-122 357 56 2 308 3 coaA Pantothenate kinase Rhodopseudomonas palustris (strain HaA2)
A8HYS9 2.85e-122 356 54 2 314 3 coaA Pantothenate kinase Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q13E42 3.24e-122 356 56 2 308 3 coaA Pantothenate kinase Rhodopseudomonas palustris (strain BisB5)
Q1QRW8 6.66e-122 355 55 2 313 3 coaA Pantothenate kinase Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
A4YJV7 2.47e-121 353 54 2 312 3 coaA Pantothenate kinase Bradyrhizobium sp. (strain ORS 278)
Q3SWF3 7.2e-121 352 54 2 312 3 coaA Pantothenate kinase Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q0S4A2 1.18e-120 352 54 3 316 3 coaA Pantothenate kinase Rhodococcus jostii (strain RHA1)
C1AYH1 1.5e-120 351 54 3 316 3 coaA Pantothenate kinase Rhodococcus opacus (strain B4)
Q89WM2 2.1e-120 351 54 2 312 3 coaA Pantothenate kinase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
A9KD67 3.66e-120 350 52 0 308 3 coaA Pantothenate kinase Coxiella burnetii (strain Dugway 5J108-111)
Q83EV9 5.61e-120 350 52 0 308 1 coaA Pantothenate kinase Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
B3Q953 7.29e-120 350 54 2 308 3 coaA Pantothenate kinase Rhodopseudomonas palustris (strain TIE-1)
Q6ND01 7.29e-120 350 54 2 308 3 coaA Pantothenate kinase Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
B6JCG7 8.4e-120 350 54 0 306 3 coaA Pantothenate kinase Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
Q21CJ9 1.09e-119 349 53 2 308 3 coaA Pantothenate kinase Rhodopseudomonas palustris (strain BisB18)
A9NAJ3 2.45e-119 348 52 0 308 3 coaA Pantothenate kinase Coxiella burnetii (strain RSA 331 / Henzerling II)
B6J2J7 2.45e-119 348 52 0 308 3 coaA Pantothenate kinase Coxiella burnetii (strain CbuG_Q212)
B6J596 2.45e-119 348 52 0 308 3 coaA Pantothenate kinase Coxiella burnetii (strain CbuK_Q154)
Q5YQ72 8.23e-119 347 53 3 316 3 coaA Pantothenate kinase Nocardia farcinica (strain IFM 10152)
Q4JU68 8.13e-118 344 52 1 309 3 coaA Pantothenate kinase Corynebacterium jeikeium (strain K411)
O86779 1.03e-117 345 52 1 309 3 coaA Pantothenate kinase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q6NI48 1.73e-117 343 54 2 314 3 coaA Pantothenate kinase Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
B3PWH7 1.91e-117 344 53 5 318 3 coaA Pantothenate kinase Rhizobium etli (strain CIAT 652)
C1A2X7 2.2e-117 343 53 3 316 3 coaA Pantothenate kinase Rhodococcus erythropolis (strain PR4 / NBRC 100887)
Q47LM9 3.62e-117 343 53 2 313 3 coaA Pantothenate kinase Thermobifida fusca (strain YX)
B5ZV89 4.34e-117 343 53 5 318 3 coaA Pantothenate kinase Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q82DL5 1e-116 342 52 1 309 3 coaA Pantothenate kinase Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q11CK5 2.62e-116 341 53 4 312 3 coaA Pantothenate kinase Chelativorans sp. (strain BNC1)
A4QCW5 3.66e-116 340 53 2 313 3 coaA Pantothenate kinase Corynebacterium glutamicum (strain R)
Q1MNG0 8.17e-116 340 52 5 318 3 coaA Pantothenate kinase Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q9K8X7 8.23e-116 339 54 2 308 3 coaA Pantothenate kinase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q5WEY6 9.08e-116 339 54 1 310 3 coaA Pantothenate kinase Shouchella clausii (strain KSM-K16)
A9FRP1 1.07e-115 339 53 1 309 3 coaA Pantothenate kinase Sorangium cellulosum (strain So ce56)
Q8NRQ2 2.16e-115 338 53 2 313 3 coaA Pantothenate kinase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
B1MKN0 3.81e-115 337 54 2 309 3 coaA Pantothenate kinase Mycobacteroides abscessus (strain ATCC 19977 / DSM 44196 / CCUG 20993 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543 / L948)
Q8FQR2 6.34e-115 338 52 2 318 3 coaA Pantothenate kinase Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
B9JXX1 1.12e-114 337 53 4 317 3 coaA Pantothenate kinase Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
C3PFC1 2.23e-114 335 52 1 314 3 coaA Pantothenate kinase Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CIP 107346 / CN-1)
Q1B4E6 2.24e-114 336 53 2 311 3 coaA Pantothenate kinase Mycobacterium sp. (strain MCS)
A1UKP2 2.24e-114 336 53 2 311 3 coaA Pantothenate kinase Mycobacterium sp. (strain KMS)
A3Q4Q8 2.24e-114 336 53 2 311 3 coaA Pantothenate kinase Mycobacterium sp. (strain JLS)
Q73WG0 7.27e-114 334 53 2 311 3 coaA Pantothenate kinase Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A4T9A9 1.04e-113 334 53 2 311 3 coaA Pantothenate kinase Mycolicibacterium gilvum (strain PYR-GCK)
A7IHN7 1.1e-113 334 50 1 317 3 coaA Pantothenate kinase Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
A1SF33 1.52e-113 334 52 1 308 3 coaA Pantothenate kinase Nocardioides sp. (strain ATCC BAA-499 / JS614)
Q92TB5 1.07e-112 332 53 5 311 3 coaA Pantothenate kinase Rhizobium meliloti (strain 1021)
P9WPA7 1.11e-112 331 52 2 311 1 coaA Pantothenate kinase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WPA6 1.11e-112 331 52 2 311 3 coaA Pantothenate kinase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U1D9 1.11e-112 331 52 2 311 3 coaA Pantothenate kinase Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1AM86 1.11e-112 331 52 2 311 3 coaA Pantothenate kinase Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KHN2 1.11e-112 331 52 2 311 3 coaA Pantothenate kinase Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P63811 1.11e-112 331 52 2 311 3 coaA Pantothenate kinase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
A6UEK1 1.64e-112 332 52 5 311 3 coaA Pantothenate kinase Sinorhizobium medicae (strain WSM419)
Q57AH1 2.57e-112 331 52 5 311 3 coaA Pantothenate kinase Brucella abortus biovar 1 (strain 9-941)
Q2YQY6 2.57e-112 331 52 5 311 3 coaA Pantothenate kinase Brucella abortus (strain 2308)
B2S986 2.57e-112 331 52 5 311 3 coaA Pantothenate kinase Brucella abortus (strain S19)
P63809 3.45e-112 330 52 5 311 3 coaA Pantothenate kinase Brucella suis biovar 1 (strain 1330)
B0CJI8 3.45e-112 330 52 5 311 3 coaA Pantothenate kinase Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VT45 3.45e-112 330 52 5 311 3 coaA Pantothenate kinase Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
P63808 3.45e-112 330 52 5 311 3 coaA Pantothenate kinase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RFX5 3.45e-112 330 52 5 311 3 coaA Pantothenate kinase Brucella melitensis biotype 2 (strain ATCC 23457)
A9M9S1 3.45e-112 330 52 5 311 3 coaA Pantothenate kinase Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q98CS9 4.24e-112 330 52 4 312 3 coaA Pantothenate kinase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
B0RD37 6.63e-112 330 51 1 308 3 coaA Pantothenate kinase Clavibacter sepedonicus
A1TE33 7.76e-112 329 52 2 311 3 coaA Pantothenate kinase Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
A5CU73 8.81e-112 329 51 1 309 3 coaA Pantothenate kinase Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382)
A6WX50 1.11e-111 329 51 3 309 3 coaA Pantothenate kinase Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
B9JG63 3.59e-111 328 52 3 318 3 coaA Pantothenate kinase Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
Q9X795 8.11e-111 327 51 2 311 3 coaA Pantothenate kinase Mycobacterium leprae (strain TN)
B8ZSH3 8.11e-111 327 51 2 311 3 coaA Pantothenate kinase Mycobacterium leprae (strain Br4923)
A0R2V9 8.75e-111 327 51 2 318 3 coaA Pantothenate kinase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q2KE63 1.18e-110 327 52 5 318 3 coaA Pantothenate kinase Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
A0PKS1 4.45e-110 325 52 2 311 3 coaA Pantothenate kinase Mycobacterium ulcerans (strain Agy99)
B2HT62 4.45e-110 325 52 2 311 3 coaA Pantothenate kinase Mycobacterium marinum (strain ATCC BAA-535 / M)
Q8UJ92 7.15e-109 322 52 5 318 3 coaA Pantothenate kinase Agrobacterium fabrum (strain C58 / ATCC 33970)
C3MBB9 1.15e-108 322 50 5 313 3 coaA Pantothenate kinase Sinorhizobium fredii (strain NBRC 101917 / NGR234)
A1UU59 1.01e-107 319 51 5 312 3 coaA Pantothenate kinase Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
Q6A6T7 1.63e-106 316 50 2 313 3 coaA Pantothenate kinase Cutibacterium acnes (strain DSM 16379 / KPA171202)
A1R8P8 5.22e-105 312 50 2 310 3 coaA Pantothenate kinase Paenarthrobacter aurescens (strain TC1)
Q6AD31 6.21e-105 312 51 1 309 3 coaA Pantothenate kinase Leifsonia xyli subsp. xyli (strain CTCB07)
A7Z6C4 4.67e-99 297 48 2 307 3 coaA Pantothenate kinase Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q8Y8I0 6.88e-98 293 46 4 306 3 coaA Pantothenate kinase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q721P1 6.88e-98 293 46 4 306 3 coaA Pantothenate kinase Listeria monocytogenes serotype 4b (strain F2365)
C1L1J5 6.88e-98 293 46 4 306 3 coaA Pantothenate kinase Listeria monocytogenes serotype 4b (strain CLIP80459)
A0AH37 9.54e-98 293 46 4 306 3 coaA Pantothenate kinase Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
B8DEL2 1.2e-97 293 46 4 306 3 coaA Pantothenate kinase Listeria monocytogenes serotype 4a (strain HCC23)
P54556 7.47e-97 291 48 2 307 3 coaA Pantothenate kinase Bacillus subtilis (strain 168)
Q92D94 1.21e-96 290 45 4 306 3 coaA Pantothenate kinase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q1WRY7 9.71e-95 285 48 2 305 3 coaA Pantothenate kinase Ligilactobacillus salivarius (strain UCC118)
B2GEA0 6.47e-91 276 44 1 305 3 coaA Pantothenate kinase Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
Q839J7 7.7e-91 276 44 1 305 3 coaA Pantothenate kinase Enterococcus faecalis (strain ATCC 700802 / V583)
B2G996 3.95e-89 271 43 1 305 3 coaA Pantothenate kinase Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VLY5 3.95e-89 271 43 1 305 3 coaA Pantothenate kinase Limosilactobacillus reuteri (strain DSM 20016)
Q036Y4 1.45e-88 270 44 2 306 3 coaA Pantothenate kinase Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
B3W953 1.45e-88 270 44 2 306 3 coaA Pantothenate kinase Lacticaseibacillus casei (strain BL23)
Q88Y75 5.78e-88 268 44 4 309 3 coaA Pantothenate kinase Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
B5E3L1 1.29e-83 257 43 4 308 3 coaA Pantothenate kinase Streptococcus pneumoniae serotype 19F (strain G54)
P63813 2.17e-83 256 42 3 302 3 coaA Pantothenate kinase Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P63812 2.17e-83 256 42 3 302 3 coaA Pantothenate kinase Streptococcus agalactiae serotype III (strain NEM316)
Q3K1D6 2.17e-83 256 42 3 302 3 coaA Pantothenate kinase Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
C1CS52 2.22e-83 256 43 4 308 3 coaA Pantothenate kinase Streptococcus pneumoniae (strain Taiwan19F-14)
C1CDI6 2.22e-83 256 43 4 308 3 coaA Pantothenate kinase Streptococcus pneumoniae (strain JJA)
B8ZNP1 2.22e-83 256 43 4 308 3 coaA Pantothenate kinase Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
C1CJS8 2.34e-83 256 43 4 308 3 coaA Pantothenate kinase Streptococcus pneumoniae (strain P1031)
Q8DQC7 2.34e-83 256 43 4 308 3 coaA Pantothenate kinase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q04L73 2.34e-83 256 43 4 308 3 coaA Pantothenate kinase Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
A4VVB5 3.81e-83 256 42 4 308 3 coaA Pantothenate kinase Streptococcus suis (strain 05ZYH33)
B1IB08 6.71e-83 255 43 4 308 3 coaA Pantothenate kinase Streptococcus pneumoniae (strain Hungary19A-6)
Q03PP4 7.08e-83 255 41 1 305 3 coaA Pantothenate kinase Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q97RH6 8.8e-83 255 43 4 308 3 coaA Pantothenate kinase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
C1C6H3 1.39e-82 254 42 4 308 3 coaA Pantothenate kinase Streptococcus pneumoniae (strain 70585)
A8AX56 5.82e-82 253 42 4 308 3 coaA Pantothenate kinase Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
Q8DU31 5.89e-82 253 42 3 301 3 coaA Pantothenate kinase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
A4W1L8 6.42e-82 253 41 3 303 3 coaA Pantothenate kinase Streptococcus suis (strain 98HAH33)
Q9CFM3 7.64e-82 253 44 5 302 3 coaA Pantothenate kinase Lactococcus lactis subsp. lactis (strain IL1403)
A2RK41 2.12e-80 249 43 5 302 3 coaA Pantothenate kinase Lactococcus lactis subsp. cremoris (strain MG1363)
Q02YD2 5.32e-80 248 43 5 302 3 coaA Pantothenate kinase Lactococcus lactis subsp. cremoris (strain SK11)
C0MG55 9.26e-80 247 42 4 303 3 coaA Pantothenate kinase Streptococcus equi subsp. zooepidemicus (strain H70)
B4U2S2 1.08e-79 247 42 4 303 3 coaA Pantothenate kinase Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
C0M9A7 2.57e-79 246 41 4 303 3 coaA Pantothenate kinase Streptococcus equi subsp. equi (strain 4047)
A3CMP3 3.75e-79 246 42 4 308 3 coaA Pantothenate kinase Streptococcus sanguinis (strain SK36)
B5XLR5 5.43e-76 238 44 4 303 3 coaA Pantothenate kinase Streptococcus pyogenes serotype M49 (strain NZ131)
Q1JLI4 8.65e-76 237 43 4 303 3 coaA Pantothenate kinase Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JBK2 8.65e-76 237 43 4 303 3 coaA Pantothenate kinase Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q8P0V9 1.1e-75 237 43 4 303 3 coaA Pantothenate kinase Streptococcus pyogenes serotype M18 (strain MGAS8232)
A2REA6 1.36e-75 237 43 4 303 3 coaA Pantothenate kinase Streptococcus pyogenes serotype M5 (strain Manfredo)
P0DA41 2.01e-75 236 43 4 303 3 coaA Pantothenate kinase Streptococcus pyogenes serotype M3 (strain SSI-1)
Q48TD0 2.01e-75 236 43 4 303 3 coaA Pantothenate kinase Streptococcus pyogenes serotype M28 (strain MGAS6180)
Q1J6D9 2.01e-75 236 43 4 303 3 coaA Pantothenate kinase Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JGM0 2.01e-75 236 43 4 303 3 coaA Pantothenate kinase Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q5XBZ4 2.01e-75 236 43 4 303 3 coaA Pantothenate kinase Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DA40 2.01e-75 236 43 4 303 3 coaA Pantothenate kinase Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q99ZH1 2.01e-75 236 43 4 303 3 coaA Pantothenate kinase Streptococcus pyogenes serotype M1
Q38ZE2 1.42e-74 234 42 2 307 3 coaA Pantothenate kinase Latilactobacillus sakei subsp. sakei (strain 23K)
Q03L30 2.16e-74 234 42 3 311 3 coaA Pantothenate kinase Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q5M4T8 7.27e-74 232 41 3 311 3 coaA Pantothenate kinase Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5M079 7.27e-74 232 41 3 311 3 coaA Pantothenate kinase Streptococcus thermophilus (strain CNRZ 1066)
P11664 4.85e-09 59 30 5 154 4 yggC Uncharacterized protein YggC Escherichia coli (strain K12)
Q38VV6 4.31e-08 56 24 9 229 3 udk Uridine kinase Latilactobacillus sakei subsp. sakei (strain 23K)
Q9FKS0 2.76e-07 55 23 10 232 1 UKL1 Uridine/cytidine kinase UKL1, chloroplastic Arabidopsis thaliana
Q081H5 9.79e-07 52 27 5 148 3 udk Uridine kinase Shewanella frigidimarina (strain NCIMB 400)
Q66I71 2.42e-06 51 26 7 166 2 uck1 Uridine-cytidine kinase 1 Danio rerio
Q8VYB2 2.88e-06 52 21 9 240 2 UKL3 Uridine kinase-like protein 3 Arabidopsis thaliana
Q5SKR5 3.38e-06 50 25 10 228 1 udk Uridine kinase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q72L53 3.38e-06 50 25 10 228 3 udk Uridine kinase Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
A6TBG6 2.08e-05 48 28 4 155 3 udk Uridine kinase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XPC8 2.08e-05 48 28 4 155 3 udk Uridine kinase Klebsiella pneumoniae (strain 342)
P26302 3.72e-05 48 27 6 174 2 None Phosphoribulokinase, chloroplastic Triticum aestivum
P37101 8.76e-05 47 26 5 165 2 prk Phosphoribulokinase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P0A8F7 9.59e-05 46 27 4 155 3 udk Uridine kinase Shigella flexneri
P0A8F4 9.59e-05 46 27 4 155 3 udk Uridine kinase Escherichia coli (strain K12)
P0A8F5 9.59e-05 46 27 4 155 3 udk Uridine kinase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A8F6 9.59e-05 46 27 4 155 3 udk Uridine kinase Escherichia coli O157:H7
A1S796 9.96e-05 46 25 4 148 3 udk Uridine kinase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
B1JPY6 0.000112 46 27 4 151 3 udk Uridine kinase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66C70 0.000112 46 27 4 151 3 udk Uridine kinase Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TKM7 0.000112 46 27 4 151 3 udk Uridine kinase Yersinia pestis (strain Pestoides F)
Q1CGU6 0.000112 46 27 4 151 3 udk Uridine kinase Yersinia pestis bv. Antiqua (strain Nepal516)
A9R2M5 0.000112 46 27 4 151 3 udk Uridine kinase Yersinia pestis bv. Antiqua (strain Angola)
Q8ZFZ9 0.000112 46 27 4 151 3 udk Uridine kinase Yersinia pestis
B2JZK5 0.000112 46 27 4 151 3 udk Uridine kinase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C9T6 0.000112 46 27 4 151 3 udk Uridine kinase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FJJ4 0.000112 46 27 4 151 3 udk Uridine kinase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q9LTY6 0.000122 47 27 8 161 2 UKL5 Uridine kinase-like protein 5 Arabidopsis thaliana
A1JTX4 0.000138 45 26 4 151 3 udk Uridine kinase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
P52623 0.00016 46 22 9 236 1 Uck1 Uridine-cytidine kinase 1 Mus musculus
P09559 0.000161 46 26 6 173 1 None Phosphoribulokinase, chloroplastic Spinacia oleracea
Q9HA47 0.000164 46 26 7 169 1 UCK1 Uridine-cytidine kinase 1 Homo sapiens
P19824 0.000177 46 27 8 176 1 PRKA Phosphoribulokinase, chloroplastic Chlamydomonas reinhardtii
B7LV30 0.000191 45 27 4 155 3 udk Uridine kinase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q6GPD9 0.000216 45 26 8 168 2 uck1-b Uridine-cytidine kinase 1-B Xenopus laevis
P27774 0.000353 45 26 8 193 2 None Phosphoribulokinase, chloroplastic Mesembryanthemum crystallinum
P25697 0.000413 45 29 8 179 1 At1g32060 Phosphoribulokinase, chloroplastic Arabidopsis thaliana
B8CPI6 0.000693 43 25 5 154 3 udk Uridine kinase Shewanella piezotolerans (strain WP3 / JCM 13877)
Q7SYM0 0.001 43 21 9 229 2 uck2a Uridine-cytidine kinase 2-A Danio rerio

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS18875
Feature type CDS
Gene coaA
Product type I pantothenate kinase
Location 2567 - 3511 (strand: -1)
Length 945 (nucleotides) / 314 (amino acids)

Contig

Accession term accessions NZ_VXKB01000011 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 30728 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2448
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00485 Phosphoribulokinase / Uridine kinase family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1072 Coenzyme transport and metabolism (H) H Panthothenate kinase

Kegg Ortholog Annotation(s)

Protein Sequence

MYKEKSLSPYLHFSRSQWATLRNSVPMTLSEQEIDELRGIHDEISIDEVIAIYLPLSRLLNFYISSNLRRQAVLEQFLGRNEAKVPYVIGIAGSVSVGKSTTARLLQALLSRWPEHRKVDLITTDGFLHPNSVLNERGIMRKKGFPESYDMHNLVRFVSEVKSGTPKVLAPVYSHLTYDIMPDKQLVVEQPDIVILEGLNVLQSGMDYPQSLHHVFVSDFVDFSIYVDAPEELLKSWYIGRFLKFRQGAFTDPNSYFHHYAQLEESEAVGIASTIWDEINGLNLHENILPTRERASLVMTKGANHMVTNVKLRK

Flanking regions ( +/- flanking 50bp)

CGGGTTTTTATGACCGGTCCAACCTGCGTAATAAAGGCAGACGTTGGTTTATGTATAAAGAAAAATCGCTCTCTCCTTATCTTCATTTCAGCCGTAGTCAGTGGGCCACTTTACGTAACTCGGTTCCGATGACCTTATCTGAGCAGGAAATTGATGAGCTGCGCGGTATTCACGATGAAATTTCAATTGATGAAGTTATCGCGATTTATCTGCCATTATCCCGGTTGCTGAATTTCTATATCAGTTCAAATCTGCGCCGCCAGGCTGTGCTCGAGCAATTTCTCGGCAGAAATGAAGCCAAAGTACCTTATGTGATTGGCATTGCCGGCAGTGTTTCTGTTGGTAAAAGTACGACTGCCCGCCTGCTTCAGGCACTTCTGAGCCGCTGGCCGGAACACAGGAAAGTTGACCTGATCACCACAGATGGTTTCCTTCATCCTAATTCGGTGCTCAATGAGCGCGGAATTATGAGAAAGAAAGGATTTCCTGAATCTTACGATATGCACAATCTCGTCCGCTTTGTGTCAGAAGTAAAATCCGGTACACCAAAAGTGCTGGCGCCGGTCTATTCACATCTGACCTATGACATCATGCCGGATAAGCAGCTTGTCGTGGAACAGCCGGATATTGTTATTCTGGAAGGATTGAATGTGCTGCAAAGCGGCATGGATTATCCGCAGTCATTGCACCATGTGTTTGTTTCAGATTTTGTGGATTTCTCTATTTATGTGGATGCACCGGAAGAGTTGCTGAAAAGCTGGTATATCGGGCGTTTCCTGAAATTTCGTCAGGGTGCGTTTACCGATCCGAACTCCTATTTCCATCATTACGCGCAATTGGAAGAGAGCGAGGCTGTCGGTATCGCATCAACTATCTGGGATGAAATCAACGGGCTCAATCTGCACGAAAATATTTTGCCAACCAGAGAGCGCGCCAGCTTAGTGATGACGAAAGGTGCAAATCACATGGTGACAAATGTGAAGCTGCGAAAATAGTAAATTCTTCTGTTAAAAACAAACCGACATCACGCCGGTTTGTTTTTTGC