Homologs in group_2453

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_19550 FBDBKF_19550 93.1 Morganella morganii S1 lexA transcriptional repressor LexA
EHELCC_16495 EHELCC_16495 93.1 Morganella morganii S2 lexA transcriptional repressor LexA
NLDBIP_16705 NLDBIP_16705 93.1 Morganella morganii S4 lexA transcriptional repressor LexA
LHKJJB_16765 LHKJJB_16765 93.1 Morganella morganii S3 lexA transcriptional repressor LexA
HKOGLL_18850 HKOGLL_18850 93.1 Morganella morganii S5 lexA transcriptional repressor LexA
PMI_RS13550 PMI_RS13550 91.6 Proteus mirabilis HI4320 lexA transcriptional repressor LexA

Distribution of the homologs in the orthogroup group_2453

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2453

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q07267 5.72e-132 371 89 1 204 3 lexA LexA repressor Providencia rettgeri
P0A273 9.32e-128 360 86 1 203 3 lexA LexA repressor Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A274 9.32e-128 360 86 1 203 3 lexA LexA repressor Salmonella typhi
B4TQQ5 9.32e-128 360 86 1 203 3 lexA LexA repressor Salmonella schwarzengrund (strain CVM19633)
B5BJW0 9.32e-128 360 86 1 203 3 lexA LexA repressor Salmonella paratyphi A (strain AKU_12601)
C0Q514 9.32e-128 360 86 1 203 3 lexA LexA repressor Salmonella paratyphi C (strain RKS4594)
A9N1L6 9.32e-128 360 86 1 203 3 lexA LexA repressor Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PL14 9.32e-128 360 86 1 203 3 lexA LexA repressor Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T1T2 9.32e-128 360 86 1 203 3 lexA LexA repressor Salmonella newport (strain SL254)
B4TDM0 9.32e-128 360 86 1 203 3 lexA LexA repressor Salmonella heidelberg (strain SL476)
B5R7T6 9.32e-128 360 86 1 203 3 lexA LexA repressor Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QZ62 9.32e-128 360 86 1 203 3 lexA LexA repressor Salmonella enteritidis PT4 (strain P125109)
B5FQR1 9.32e-128 360 86 1 203 3 lexA LexA repressor Salmonella dublin (strain CT_02021853)
Q57GZ0 9.32e-128 360 86 1 203 3 lexA LexA repressor Salmonella choleraesuis (strain SC-B67)
A9MGP6 9.32e-128 360 86 1 203 3 lexA LexA repressor Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5F1Q6 9.32e-128 360 86 1 203 3 lexA LexA repressor Salmonella agona (strain SL483)
Q7MZB8 2.97e-127 359 85 1 204 3 lexA LexA repressor Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A1JRT9 4.88e-127 359 86 1 203 3 lexA LexA repressor Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
C6DKD2 1.08e-126 358 84 1 204 3 lexA LexA repressor Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q3YUU1 1.17e-126 358 85 1 203 3 lexA LexA repressor Shigella sonnei (strain Ss046)
P0A7C5 1.17e-126 358 85 1 203 3 lexA LexA repressor Shigella flexneri
Q0SXR0 1.17e-126 358 85 1 203 3 lexA LexA repressor Shigella flexneri serotype 5b (strain 8401)
Q327V0 1.17e-126 358 85 1 203 3 lexA LexA repressor Shigella dysenteriae serotype 1 (strain Sd197)
Q31TV1 1.17e-126 358 85 1 203 3 lexA LexA repressor Shigella boydii serotype 4 (strain Sb227)
B2TX73 1.17e-126 358 85 1 203 3 lexA LexA repressor Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q1R3P3 1.17e-126 358 85 1 203 3 lexA LexA repressor Escherichia coli (strain UTI89 / UPEC)
B1LPK8 1.17e-126 358 85 1 203 3 lexA LexA repressor Escherichia coli (strain SMS-3-5 / SECEC)
B6I5Q8 1.17e-126 358 85 1 203 3 lexA LexA repressor Escherichia coli (strain SE11)
B7NFY7 1.17e-126 358 85 1 203 3 lexA LexA repressor Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A7C2 1.17e-126 358 85 1 203 1 lexA LexA repressor Escherichia coli (strain K12)
B1IUK9 1.17e-126 358 85 1 203 3 lexA LexA repressor Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A7C3 1.17e-126 358 85 1 203 3 lexA LexA repressor Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TA20 1.17e-126 358 85 1 203 3 lexA LexA repressor Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AIM0 1.17e-126 358 85 1 203 3 lexA LexA repressor Escherichia coli O1:K1 / APEC
A8A7E3 1.17e-126 358 85 1 203 3 lexA LexA repressor Escherichia coli O9:H4 (strain HS)
B1XC42 1.17e-126 358 85 1 203 3 lexA LexA repressor Escherichia coli (strain K12 / DH10B)
C5A136 1.17e-126 358 85 1 203 3 lexA LexA repressor Escherichia coli (strain K12 / MC4100 / BW2952)
B7M7V6 1.17e-126 358 85 1 203 3 lexA LexA repressor Escherichia coli O8 (strain IAI1)
B7N2Q0 1.17e-126 358 85 1 203 3 lexA LexA repressor Escherichia coli O81 (strain ED1a)
B7NSK5 1.17e-126 358 85 1 203 3 lexA LexA repressor Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5Z184 1.17e-126 358 85 1 203 3 lexA LexA repressor Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A7C4 1.17e-126 358 85 1 203 3 lexA LexA repressor Escherichia coli O157:H7
B7LAZ0 1.17e-126 358 85 1 203 3 lexA LexA repressor Escherichia coli (strain 55989 / EAEC)
B7MJ33 1.17e-126 358 85 1 203 3 lexA LexA repressor Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UPK4 1.17e-126 358 85 1 203 3 lexA LexA repressor Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZUR5 1.17e-126 358 85 1 203 3 lexA LexA repressor Escherichia coli O139:H28 (strain E24377A / ETEC)
B4EYR3 2.48e-126 357 90 1 203 3 lexA LexA repressor Proteus mirabilis (strain HI4320)
A8AN85 3.4e-126 357 85 1 203 3 lexA LexA repressor Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q04596 1.06e-125 355 84 1 204 3 lexA LexA repressor Pectobacterium carotovorum subsp. carotovorum
B7LL15 2.06e-125 355 84 1 203 3 lexA LexA repressor Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B1JNE3 2.4e-125 355 85 1 203 3 lexA LexA repressor Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66FG7 2.4e-125 355 85 1 203 3 lexA LexA repressor Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TRU5 2.4e-125 355 85 1 203 3 lexA LexA repressor Yersinia pestis (strain Pestoides F)
Q1CE98 2.4e-125 355 85 1 203 3 lexA LexA repressor Yersinia pestis bv. Antiqua (strain Nepal516)
A9R273 2.4e-125 355 85 1 203 3 lexA LexA repressor Yersinia pestis bv. Antiqua (strain Angola)
Q8ZJ16 2.4e-125 355 85 1 203 3 lexA LexA repressor Yersinia pestis
B2K1U7 2.4e-125 355 85 1 203 3 lexA LexA repressor Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C0U1 2.4e-125 355 85 1 203 3 lexA LexA repressor Yersinia pestis bv. Antiqua (strain Antiqua)
A7FN96 2.4e-125 355 85 1 203 3 lexA LexA repressor Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
C5B718 3.76e-125 354 84 1 203 3 lexA LexA repressor Edwardsiella ictaluri (strain 93-146)
A8GKB4 6.22e-125 353 85 1 203 3 lexA LexA repressor Serratia proteamaculans (strain 568)
Q6D9I5 3.44e-124 352 83 1 204 3 lexA LexA repressor Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A4W5F6 1.31e-123 350 83 1 203 3 lexA LexA repressor Enterobacter sp. (strain 638)
A6TGV2 5.77e-123 348 83 1 203 3 lexA LexA repressor Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XXY9 6.29e-123 348 83 1 203 3 lexA LexA repressor Klebsiella pneumoniae (strain 342)
A7MPP3 1.1e-122 348 83 1 203 3 lexA LexA repressor Cronobacter sakazakii (strain ATCC BAA-894)
B2VKA1 3.12e-121 344 82 1 203 3 lexA LexA repressor Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q2NR09 5.64e-119 338 80 1 203 3 lexA LexA repressor Sodalis glossinidius (strain morsitans)
Q7MQ85 3.17e-109 314 73 1 206 3 lexA LexA repressor Vibrio vulnificus (strain YJ016)
Q8DD47 3.17e-109 314 73 1 206 3 lexA LexA repressor Vibrio vulnificus (strain CMCP6)
C3LPT4 3.03e-107 309 72 1 208 3 lexA LexA repressor Vibrio cholerae serotype O1 (strain M66-2)
Q9KVP9 3.03e-107 309 72 1 208 3 lexA LexA repressor Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F4F6 3.03e-107 309 72 1 208 3 lexA LexA repressor Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
P57917 1.22e-105 305 71 2 207 3 lexA LexA repressor Pasteurella multocida (strain Pm70)
B0USF0 2.99e-105 304 70 2 206 3 lexA LexA repressor Histophilus somni (strain 2336)
Q0I2G7 2.99e-105 304 70 2 206 3 lexA LexA repressor Histophilus somni (strain 129Pt)
B4S1W7 6.15e-105 303 70 1 207 3 lexA LexA repressor Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
A3Q951 1.75e-104 302 70 1 205 3 lexA LexA repressor Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q65UK9 3.98e-103 299 69 2 209 3 lexA LexA repressor Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
B8CUX0 4.35e-103 298 69 1 206 3 lexA LexA repressor Shewanella piezotolerans (strain WP3 / JCM 13877)
A1SBC7 4.75e-103 298 69 1 206 3 lexA LexA repressor Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q15MZ2 9.58e-103 298 70 1 206 3 lexA LexA repressor Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
B1KM68 1.11e-102 297 69 1 205 3 lexA LexA repressor Shewanella woodyi (strain ATCC 51908 / MS32)
A4STB3 1.13e-102 297 69 1 206 3 lexA LexA repressor Aeromonas salmonicida (strain A449)
B0TNT3 1.89e-102 297 69 1 205 3 lexA LexA repressor Shewanella halifaxensis (strain HAW-EB4)
A6VMQ0 3.36e-102 296 69 2 206 3 lexA LexA repressor Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
A8H9S0 3.52e-101 293 68 1 205 3 lexA LexA repressor Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
A8FPP0 5.76e-101 293 68 1 205 3 lexA LexA repressor Shewanella sediminis (strain HAW-EB3)
A1SR67 6.04e-101 293 68 1 208 3 lexA LexA repressor Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
A7N0W6 2.7e-100 291 74 1 205 3 lexA LexA repressor Vibrio campbellii (strain ATCC BAA-1116)
Q12ID6 1.26e-99 290 68 1 204 3 lexA LexA repressor Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q48AA9 7.18e-99 288 67 0 203 3 lexA LexA repressor Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q87KN2 1.91e-98 286 72 1 205 3 lexA LexA repressor Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A5UHQ3 3.24e-98 286 67 2 206 3 lexA LexA repressor Haemophilus influenzae (strain PittGG)
A5UDX6 3.24e-98 286 67 2 206 3 lexA LexA repressor Haemophilus influenzae (strain PittEE)
Q4QME9 3.24e-98 286 67 2 206 3 lexA LexA repressor Haemophilus influenzae (strain 86-028NP)
Q44069 1.87e-97 284 69 1 206 3 lexA LexA repressor Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A1U269 2.39e-97 284 69 1 201 3 lexA LexA repressor Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
P44858 2.54e-97 284 67 2 206 3 lexA LexA repressor Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
C4L7X7 3.97e-97 283 68 2 205 3 lexA LexA repressor Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
B5FCB2 1.16e-96 282 72 1 207 3 lexA LexA repressor Aliivibrio fischeri (strain MJ11)
B6ENU0 2.01e-96 281 71 1 206 3 lexA LexA repressor Aliivibrio salmonicida (strain LFI1238)
B7VM94 2.39e-96 281 72 1 205 3 lexA LexA repressor Vibrio atlanticus (strain LGP32)
Q5E209 6.56e-96 280 71 1 207 3 lexA LexA repressor Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q5QUP5 1.17e-95 280 67 1 201 3 lexA LexA repressor Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q0HPW6 1.25e-95 280 70 1 205 3 lexA LexA repressor Shewanella sp. (strain MR-7)
Q089E2 5.41e-95 278 69 0 203 3 lexA LexA repressor Shewanella frigidimarina (strain NCIMB 400)
Q0HDL5 5.72e-95 278 70 1 205 3 lexA LexA repressor Shewanella sp. (strain MR-4)
Q8E8Q8 1.79e-94 276 69 1 205 3 lexA LexA repressor Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A0L2D8 2.27e-94 276 69 1 205 3 lexA LexA repressor Shewanella sp. (strain ANA-3)
A9KUW8 1.1e-92 272 69 1 205 3 lexA LexA repressor Shewanella baltica (strain OS195)
A6WU05 1.1e-92 272 69 1 205 3 lexA LexA repressor Shewanella baltica (strain OS185)
A3CYX7 1.1e-92 272 69 1 205 3 lexA LexA repressor Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8ECL9 1.1e-92 272 69 1 205 3 lexA LexA repressor Shewanella baltica (strain OS223)
B8F317 1.35e-92 272 64 1 203 3 lexA LexA repressor Glaesserella parasuis serovar 5 (strain SH0165)
Q2SKC5 1.39e-92 271 65 0 199 3 lexA LexA repressor Hahella chejuensis (strain KCTC 2396)
B3GXZ4 2.48e-92 271 64 1 206 3 lexA LexA repressor Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A1RE93 3.62e-92 271 69 1 205 3 lexA LexA repressor Shewanella sp. (strain W3-18-1)
A4YC04 3.62e-92 271 69 1 205 3 lexA LexA repressor Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
B0BQ48 3.79e-92 271 63 1 206 3 lexA LexA repressor Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
A3N1B4 3.79e-92 271 63 1 206 3 lexA LexA repressor Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q6LVS1 1.14e-91 269 73 1 191 3 lexA LexA repressor Photobacterium profundum (strain SS9)
C5BIH2 6.26e-91 267 67 2 203 3 lexA LexA repressor Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q7VNI6 2.86e-90 266 62 1 207 3 lexA LexA repressor Haemophilus ducreyi (strain 35000HP / ATCC 700724)
A4XSN5 3.13e-87 258 62 1 203 3 lexA LexA repressor Pseudomonas mendocina (strain ymp)
P0A154 5.47e-87 258 62 1 201 3 lexA LexA repressor Pseudomonas putida
P0A153 5.47e-87 258 62 1 201 3 lexA1 LexA repressor 1 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B3PEX1 1.92e-86 256 63 2 201 3 lexA LexA repressor Cellvibrio japonicus (strain Ueda107)
Q87ZB9 2.17e-86 256 61 1 201 3 lexA1 LexA repressor 1 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
P37452 2.92e-86 256 63 1 203 1 lexA LexA repressor Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02PH1 2.92e-86 256 63 1 203 3 lexA LexA repressor Pseudomonas aeruginosa (strain UCBPP-PA14)
B7UYS3 2.92e-86 256 63 1 203 3 lexA LexA repressor Pseudomonas aeruginosa (strain LESB58)
A6V389 4.06e-86 255 62 1 203 3 lexA LexA repressor Pseudomonas aeruginosa (strain PA7)
Q8KT78 8.62e-86 254 62 1 201 3 lexA LexA repressor Pseudomonas chlororaphis
C1DQZ4 2.11e-85 253 60 1 201 3 lexA LexA repressor Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q21JT2 1.69e-84 251 63 2 201 3 lexA LexA repressor Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
A6VX60 7.26e-84 250 60 1 204 3 lexA LexA repressor Marinomonas sp. (strain MWYL1)
Q3SIT9 8.9e-84 249 61 1 200 3 lexA LexA repressor Thiobacillus denitrificans (strain ATCC 25259)
B2UAG1 2.9e-83 249 59 1 212 3 lexA LexA repressor Ralstonia pickettii (strain 12J)
Q8XZU1 6.02e-83 248 59 1 212 3 lexA LexA repressor Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
A4G713 9.44e-83 248 59 3 221 3 lexA LexA repressor Herminiimonas arsenicoxydans
A6SXJ3 1.03e-80 242 59 3 221 3 lexA LexA repressor Janthinobacterium sp. (strain Marseille)
Q9AGM5 1.63e-80 242 57 1 218 3 lexA LexA repressor Cupriavidus necator
Q1LLW6 1.63e-80 242 57 1 218 3 lexA LexA repressor Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q13ZI7 6.17e-80 240 56 1 216 3 lexA LexA repressor Paraburkholderia xenovorans (strain LB400)
B2T3L9 1.5e-79 239 56 1 216 3 lexA LexA repressor Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
A1VNK0 2.1e-79 239 59 2 216 3 lexA LexA repressor Polaromonas naphthalenivorans (strain CJ2)
A2SGY5 2.47e-79 239 57 1 216 3 lexA LexA repressor Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
Q0A9N9 2.64e-79 238 59 1 200 3 lexA LexA repressor Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
B3R2P9 4.36e-79 238 56 3 218 3 lexA LexA repressor Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q0K9E3 9.18e-79 237 56 3 218 3 lexA LexA repressor Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
B2JK89 1.11e-78 237 55 1 216 3 lexA LexA repressor Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
C5CKV7 1.35e-78 237 58 3 219 3 lexA LexA repressor Variovorax paradoxus (strain S110)
Q21U48 1.95e-78 237 58 2 216 3 lexA LexA repressor Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
A9BWH9 2.68e-78 236 56 2 216 3 lexA LexA repressor Delftia acidovorans (strain DSM 14801 / SPH-1)
Q2L247 4.15e-78 235 58 2 206 3 lexA LexA repressor Bordetella avium (strain 197N)
Q46ZR1 9.21e-78 235 55 1 218 3 lexA LexA repressor Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q2SVP7 9.83e-78 234 56 2 217 3 lexA LexA repressor Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63TX7 1e-77 234 56 2 217 3 lexA LexA repressor Burkholderia pseudomallei (strain K96243)
A3N959 1e-77 234 56 2 217 3 lexA LexA repressor Burkholderia pseudomallei (strain 668)
Q3JSP6 1e-77 234 56 2 217 3 lexA LexA repressor Burkholderia pseudomallei (strain 1710b)
A3NUV3 1e-77 234 56 2 217 3 lexA LexA repressor Burkholderia pseudomallei (strain 1106a)
A1V472 1e-77 234 56 2 217 3 lexA LexA repressor Burkholderia mallei (strain SAVP1)
Q62K79 1e-77 234 56 2 217 3 lexA LexA repressor Burkholderia mallei (strain ATCC 23344)
A2S339 1e-77 234 56 2 217 3 lexA LexA repressor Burkholderia mallei (strain NCTC 10229)
A3MJD2 1e-77 234 56 2 217 3 lexA LexA repressor Burkholderia mallei (strain NCTC 10247)
Q1QVT7 1.64e-77 234 59 1 194 3 lexA LexA repressor Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q0BFL9 2.52e-77 233 56 2 215 3 lexA LexA repressor Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B4E8S4 3.61e-77 233 55 2 217 3 lexA LexA repressor Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A4JE56 4.44e-77 233 56 2 215 3 lexA LexA repressor Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q39GT3 4.64e-77 233 55 2 217 3 lexA LexA repressor Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
B1YPM6 4.64e-77 233 55 2 217 3 lexA LexA repressor Burkholderia ambifaria (strain MC40-6)
A9AIX7 4.69e-77 233 55 2 217 3 lexA LexA repressor Burkholderia multivorans (strain ATCC 17616 / 249)
Q1BWH8 5.29e-77 233 55 2 217 3 lexA LexA repressor Burkholderia orbicola (strain AU 1054)
B1K0Z6 5.29e-77 233 55 2 217 3 lexA LexA repressor Burkholderia orbicola (strain MC0-3)
A0K775 5.29e-77 233 55 2 217 3 lexA LexA repressor Burkholderia cenocepacia (strain HI2424)
A1TQ93 1.63e-76 232 56 2 216 3 lexA LexA repressor Paracidovorax citrulli (strain AAC00-1)
A1W897 1.66e-76 232 56 2 216 3 lexA LexA repressor Acidovorax sp. (strain JS42)
B9MI78 1.66e-76 232 56 2 216 3 lexA LexA repressor Acidovorax ebreus (strain TPSY)
A1WSJ3 4.4e-76 231 56 3 216 3 lexA LexA repressor Verminephrobacter eiseniae (strain EF01-2)
Q129C4 5.11e-76 231 56 2 216 3 lexA LexA repressor Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q7W0T5 6.32e-76 230 56 3 211 3 lexA LexA repressor Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q5P4A1 1.07e-75 229 57 1 197 3 lexA LexA repressor Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q7VRY0 1.3e-75 229 54 2 213 3 lexA LexA repressor Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7WCK0 1.3e-75 229 54 2 213 3 lexA LexA repressor Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
A1K776 2.54e-74 225 55 1 197 3 lexA LexA repressor Azoarcus sp. (strain BH72)
Q47EP6 2.49e-73 223 55 1 198 3 lexA LexA repressor Dechloromonas aromatica (strain RCB)
A9IR25 2.71e-73 224 55 3 217 3 lexA LexA repressor Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
B5EJ91 1.77e-70 216 54 2 201 3 lexA LexA repressor Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7JBX0 1.77e-70 216 54 2 201 3 lexA LexA repressor Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
B1Y250 9.35e-70 215 51 2 222 3 lexA LexA repressor Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
A1WXU3 2.2e-68 211 51 1 212 3 lexA LexA repressor Halorhodospira halophila (strain DSM 244 / SL1)
Q605V8 2.87e-67 207 53 1 200 3 lexA LexA repressor Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q0VQU1 5.52e-50 164 47 3 204 3 lexA LexA repressor Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
B0U1K7 1.52e-48 160 41 2 208 3 lexA LexA repressor Xylella fastidiosa (strain M12)
B4SRA9 1.91e-48 160 43 3 207 3 lexA LexA repressor Stenotrophomonas maltophilia (strain R551-3)
Q87F45 6.36e-48 159 41 2 208 3 lexA LexA repressor Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I679 6.36e-48 159 41 2 208 3 lexA LexA repressor Xylella fastidiosa (strain M23)
Q9PH24 1.58e-47 157 41 2 208 3 lexA LexA repressor Xylella fastidiosa (strain 9a5c)
P59479 2.45e-46 154 39 2 202 3 lexA2 LexA repressor 2 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q881U0 5.08e-46 154 41 2 201 3 lexA2 LexA repressor 2 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q8P9X2 5.58e-46 154 40 2 210 3 lexA2 LexA repressor 2 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q93MQ9 5.89e-46 154 41 2 209 3 lexA LexA repressor Xanthomonas campestris
Q5GYM5 7.72e-46 153 41 2 209 3 lexA2 LexA repressor 2 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
P60512 1.33e-45 153 41 2 209 1 lexA LexA repressor Xanthomonas citri
P60511 1.33e-45 153 41 2 209 3 lexA2 LexA repressor 2 Xanthomonas axonopodis pv. citri (strain 306)
Q5GX75 1.33e-43 147 41 3 203 3 lexA1 LexA repressor 1 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q8PN77 2.16e-43 147 41 3 203 3 lexA1 LexA repressor 1 Xanthomonas axonopodis pv. citri (strain 306)
Q8PBM1 3.3e-43 146 40 3 203 3 lexA1 LexA repressor 1 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B8FIX5 7.18e-42 143 39 3 203 3 lexA LexA repressor Desulfatibacillum aliphaticivorans
Q3A3S5 5.7e-41 140 41 2 200 3 lexA LexA repressor Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
A5N8J0 4.31e-38 133 39 2 179 3 lexA LexA repressor Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9E1Z5 4.31e-38 133 39 2 179 3 lexA LexA repressor Clostridium kluyveri (strain NBRC 12016)
Q1D406 8.12e-38 133 40 5 215 3 lexA LexA repressor Myxococcus xanthus (strain DK1622)
B0SPA2 1.01e-37 132 39 3 205 3 lexA LexA repressor Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris)
B0SFV4 1.01e-37 132 39 3 205 3 lexA LexA repressor Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames)
A5GAQ4 1.17e-37 132 40 1 200 3 lexA LexA repressor Geotalea uraniireducens (strain Rf4)
P61609 2.93e-37 131 40 2 204 3 lexA2 LexA repressor 2 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
A0Q0N2 6.85e-37 130 36 3 197 3 lexA LexA repressor Clostridium novyi (strain NT)
C6DZY8 9.1e-37 130 37 1 202 3 lexA LexA repressor Geobacter sp. (strain M21)
P0DN68 1.57e-36 130 34 3 207 1 lexA LexA repressor Fibrobacter succinogenes (strain ATCC 19169 / S85)
Q97I23 5.49e-36 128 36 2 179 3 lexA LexA repressor Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
B5EA68 1.2e-35 127 36 1 202 3 lexA LexA repressor Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
A0LGS1 3.99e-35 125 39 3 198 3 lexA LexA repressor Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
B1KS97 5.14e-35 125 34 3 201 3 lexA LexA repressor Clostridium botulinum (strain Loch Maree / Type A3)
A7GE39 5.14e-35 125 34 3 201 3 lexA LexA repressor Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
B1IM63 5.14e-35 125 34 3 201 3 lexA LexA repressor Clostridium botulinum (strain Okra / Type B1)
C1FNT4 5.14e-35 125 34 3 201 3 lexA LexA repressor Clostridium botulinum (strain Kyoto / Type A2)
C3KX30 5.14e-35 125 34 3 201 3 lexA LexA repressor Clostridium botulinum (strain 657 / Type Ba4)
P61608 6.96e-35 125 38 1 199 3 lexA1 LexA repressor 1 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q67NM2 1.08e-34 124 37 3 204 3 lexA LexA repressor Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
A5I2R7 2.28e-34 124 34 3 201 3 lexA LexA repressor Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FUK4 2.28e-34 124 34 3 201 3 lexA LexA repressor Clostridium botulinum (strain ATCC 19397 / Type A)
A4XL42 2.66e-34 124 37 3 205 3 lexA LexA repressor Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
Q187P1 3.49e-34 123 38 4 206 3 lexA LexA repressor Clostridioides difficile (strain 630)
Q0AY82 4.56e-34 123 35 2 200 3 lexA LexA repressor Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
Q24X76 5.18e-34 123 36 2 201 3 lexA LexA repressor Desulfitobacterium hafniense (strain Y51)
B8FWD3 5.18e-34 123 36 2 201 3 lexA LexA repressor Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
C0ZES6 7.67e-34 122 36 4 208 3 lexA LexA repressor Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
Q3ACC4 9.07e-34 122 36 4 200 3 lexA LexA repressor Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q6HFB0 1.59e-33 122 36 6 209 3 lexA LexA repressor Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q637D7 1.59e-33 122 36 6 209 3 lexA LexA repressor Bacillus cereus (strain ZK / E33L)
Q81A92 1.59e-33 122 36 6 209 3 lexA LexA repressor Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B9IUL2 1.59e-33 122 36 6 209 3 lexA LexA repressor Bacillus cereus (strain Q1)
P61606 1.59e-33 122 36 6 209 3 lexA LexA repressor Bacillus cereus (strain ATCC 10987 / NRS 248)
B7JIC6 1.59e-33 122 36 6 209 3 lexA LexA repressor Bacillus cereus (strain AH820)
Q81Y06 1.59e-33 122 36 6 209 3 lexA LexA repressor Bacillus anthracis
A0RH75 1.59e-33 122 36 6 209 3 lexA LexA repressor Bacillus thuringiensis (strain Al Hakam)
B9K9N0 2.64e-33 121 38 5 204 3 lexA LexA repressor Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E)
A9VPX5 2.87e-33 121 37 6 207 3 lexA LexA repressor Bacillus mycoides (strain KBAB4)
Q8F663 3.21e-33 120 36 4 206 3 lexA LexA repressor Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
P61611 3.21e-33 120 36 4 206 3 lexA LexA repressor Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
C5D9K3 3.94e-33 120 36 5 209 3 lexA LexA repressor Geobacillus sp. (strain WCH70)
O86948 3.99e-33 120 39 5 202 3 lexA LexA repressor Thermotoga neapolitana
Q0STQ8 4.39e-33 120 36 2 186 3 lexA LexA repressor Clostridium perfringens (strain SM101 / Type A)
Q0TRD0 4.74e-33 120 36 2 186 3 lexA LexA repressor Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
B1HRJ5 8.1e-33 120 37 4 190 3 lexA LexA repressor Lysinibacillus sphaericus (strain C3-41)
Q8XL81 1.02e-32 119 34 3 203 3 lexA LexA repressor Clostridium perfringens (strain 13 / Type A)
Q053A1 1.12e-32 119 37 4 206 3 lexA LexA repressor Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04RH1 1.12e-32 119 37 4 206 3 lexA LexA repressor Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
A7GR32 4.74e-32 118 35 5 209 3 lexA LexA repressor Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q5HPK2 6.14e-32 117 36 4 208 3 lexA LexA repressor Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q5L0C3 6.3e-32 117 36 4 211 3 lexA LexA repressor Geobacillus kaustophilus (strain HTA426)
A3DDH9 6.75e-32 117 30 2 210 3 lexA LexA repressor Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
A5IN94 8.12e-32 117 38 5 202 3 lexA LexA repressor Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
Q4L648 8.33e-32 117 37 6 210 3 lexA LexA repressor Staphylococcus haemolyticus (strain JCSC1435)
O33927 8.66e-32 117 38 5 202 1 lexA LexA repressor Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q895H6 9.08e-32 117 36 4 197 3 lexA LexA repressor Clostridium tetani (strain Massachusetts / E88)
Q8EQM5 1.2e-31 117 35 6 209 3 lexA LexA repressor Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q39VQ1 1.49e-31 116 36 1 200 3 lexA LexA repressor Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
A9F881 2.14e-31 117 34 4 231 3 lexA LexA repressor Sorangium cellulosum (strain So ce56)
Q9KAD3 2.74e-31 116 33 3 209 3 lexA LexA repressor Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q03B55 3.23e-31 115 42 5 173 3 lexA LexA repressor Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
B3WC17 3.23e-31 115 42 5 173 3 lexA LexA repressor Lacticaseibacillus casei (strain BL23)
B4UCX8 4.38e-31 116 36 5 230 3 lexA LexA repressor Anaeromyxobacter sp. (strain K)
B1L838 4.48e-31 115 37 5 202 3 lexA LexA repressor Thermotoga sp. (strain RQ2)
C4L2T2 8.79e-31 114 33 4 208 3 lexA LexA repressor Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
B8JA57 9.31e-31 115 35 5 234 3 lexA LexA repressor Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
A4IMK1 9.42e-31 114 35 4 208 3 lexA LexA repressor Geobacillus thermodenitrificans (strain NG80-2)
A4J5P4 9.78e-31 115 34 2 215 3 lexA LexA repressor Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
A6TR70 1.13e-30 114 33 2 204 3 lexA LexA repressor Alkaliphilus metalliredigens (strain QYMF)
A7HC61 1.52e-30 115 35 6 231 3 lexA LexA repressor Anaeromyxobacter sp. (strain Fw109-5)
Q2IIJ0 1.77e-30 114 34 5 235 3 lexA LexA repressor Anaeromyxobacter dehalogenans (strain 2CP-C)
A8FDP7 2.52e-30 113 34 4 208 3 lexA LexA repressor Bacillus pumilus (strain SAFR-032)
P31080 6.03e-30 112 34 4 207 1 lexA LexA repressor Bacillus subtilis (strain 168)
B8I2Q1 8.36e-30 112 31 3 214 3 lexA LexA repressor Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
A7Z552 1.01e-29 112 34 4 208 3 lexA LexA repressor Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
A8MFC9 1.3e-29 111 31 2 204 3 lexA LexA repressor Alkaliphilus oremlandii (strain OhILAs)
Q65J42 1.4e-29 111 34 4 209 3 lexA LexA repressor Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
A6QGP1 1.65e-29 111 34 4 209 3 lexA LexA repressor Staphylococcus aureus (strain Newman)
Q5FJL4 1.86e-29 111 33 4 203 3 lexA LexA repressor Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q93SM0 1.98e-29 111 34 4 209 3 lexA LexA repressor Staphylococcus aureus (strain MW2)
Q6G9L9 1.98e-29 111 34 4 209 3 lexA LexA repressor Staphylococcus aureus (strain MSSA476)
Q6GH67 1.98e-29 111 34 4 209 3 lexA LexA repressor Staphylococcus aureus (strain MRSA252)
Q9L4P1 1.98e-29 111 34 4 209 3 lexA LexA repressor Staphylococcus aureus (strain COL)
Q2FYU1 1.98e-29 111 34 4 209 3 lexA LexA repressor Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH94 1.98e-29 111 34 4 209 3 lexA LexA repressor Staphylococcus aureus (strain USA300)
P65820 2.35e-29 111 34 4 209 3 lexA LexA repressor Staphylococcus aureus (strain N315)
P65819 2.35e-29 111 34 4 209 3 lexA LexA repressor Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q2YXS8 2.35e-29 111 34 4 209 3 lexA LexA repressor Staphylococcus aureus (strain bovine RF122 / ET3-1)
A7X1Z4 2.35e-29 111 34 4 209 3 lexA LexA repressor Staphylococcus aureus (strain Mu3 / ATCC 700698)
A5D2J8 5.05e-29 110 38 3 181 3 lexA LexA repressor Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
A0AIA3 5.76e-29 110 32 5 204 3 lexA LexA repressor Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q92C51 6.48e-29 110 32 5 204 3 lexA LexA repressor Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q049T1 1.79e-28 108 33 4 208 3 lexA LexA repressor Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q1G9M5 1.79e-28 108 33 4 208 3 lexA LexA repressor Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
Q47MY4 1.83e-28 110 33 2 213 3 lexA LexA repressor Thermobifida fusca (strain YX)
Q5WG03 1.84e-28 108 31 3 210 3 lexA LexA repressor Shouchella clausii (strain KSM-K16)
A1A2G3 2.26e-28 110 33 3 201 3 lexA LexA repressor Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a)
Q1WUI6 3.66e-28 108 33 5 203 3 lexA LexA repressor Ligilactobacillus salivarius (strain UCC118)
Q5YT43 3.85e-28 108 33 4 202 3 lexA2 LexA repressor 2 Nocardia farcinica (strain IFM 10152)
B8DG25 3.91e-28 107 31 5 204 3 lexA LexA repressor Listeria monocytogenes serotype 4a (strain HCC23)
Q720B9 3.91e-28 107 31 5 204 3 lexA LexA repressor Listeria monocytogenes serotype 4b (strain F2365)
C1L2K9 3.91e-28 107 31 5 204 3 lexA LexA repressor Listeria monocytogenes serotype 4b (strain CLIP80459)
Q8Y7H7 4.17e-28 107 31 5 204 3 lexA LexA repressor Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q2RJF5 5.08e-28 107 33 2 203 3 lexA LexA repressor Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
A8YVS7 6.41e-28 107 33 4 203 3 lexA LexA repressor Lactobacillus helveticus (strain DPC 4571)
B1YE71 1.66e-27 106 32 4 206 3 lexA LexA repressor Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
B7IDD1 1.85e-27 105 34 4 200 3 lexA LexA repressor Thermosipho africanus (strain TCF52B)
Q49XD4 1.9e-27 106 33 5 210 3 lexA LexA repressor Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
P9WHR7 1.92e-27 107 33 2 196 1 lexA LexA repressor Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WHR6 1.92e-27 107 33 2 196 3 lexA LexA repressor Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U672 1.92e-27 107 33 2 196 3 lexA LexA repressor Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1AFH9 2.02e-27 107 33 2 196 3 lexA LexA repressor Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KM58 2.02e-27 107 33 2 196 3 lexA LexA repressor Mycobacterium bovis (strain BCG / Pasteur 1173P2)
Q7TY15 2.02e-27 107 33 2 196 3 lexA LexA repressor Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
B1ZZZ4 3.04e-27 105 35 5 199 1 lexA LexA repressor Opitutus terrae (strain DSM 11246 / JCM 15787 / PB90-1)
Q834R0 3.75e-27 105 33 4 206 3 lexA LexA repressor Enterococcus faecalis (strain ATCC 700802 / V583)
B9DP69 5.08e-27 105 34 5 209 3 lexA LexA repressor Staphylococcus carnosus (strain TM300)
B2GBL2 5.43e-27 105 31 3 204 3 lexA LexA repressor Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
Q5YP21 1.7e-26 103 31 4 207 3 lexA1 LexA repressor 1 Nocardia farcinica (strain IFM 10152)
Q044D8 1.71e-26 103 32 4 202 3 lexA LexA repressor Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
Q8G4R6 1.81e-26 104 30 1 207 3 lexA LexA repressor Bifidobacterium longum (strain NCC 2705)
B3DQB4 1.81e-26 104 30 1 207 3 lexA LexA repressor Bifidobacterium longum (strain DJO10A)
P61610 1.89e-26 103 32 4 202 3 lexA LexA repressor Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
O86847 2.05e-26 104 33 2 193 3 lexA LexA repressor Streptomyces clavuligerus
Q03FU3 2.2e-26 103 30 4 211 3 lexA LexA repressor Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
Q49848 2.61e-26 103 30 1 197 3 lexA LexA repressor Mycobacterium leprae (strain TN)
B8ZQU5 2.61e-26 103 30 1 197 3 lexA LexA repressor Mycobacterium leprae (strain Br4923)
Q82KE0 2.78e-26 103 33 2 193 3 lexA LexA repressor Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
A1T7V4 3.29e-26 103 32 2 195 3 lexA LexA repressor Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
O69979 3.3e-26 103 33 2 193 3 lexA LexA repressor Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
A0PT76 3.43e-26 103 32 2 194 3 lexA LexA repressor Mycobacterium ulcerans (strain Agy99)
A6LM87 3.69e-26 102 33 4 200 3 lexA LexA repressor Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429)
B2HLX8 3.89e-26 103 32 2 194 3 lexA LexA repressor Mycobacterium marinum (strain ATCC BAA-535 / M)
B7GQ64 4.14e-26 103 30 2 207 3 lexA LexA repressor Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)
Q1BA08 5.08e-26 103 32 2 194 3 lexA LexA repressor Mycobacterium sp. (strain MCS)
A1UF04 5.08e-26 103 32 2 194 3 lexA LexA repressor Mycobacterium sp. (strain KMS)
A3PYG6 5.08e-26 103 32 2 194 3 lexA LexA repressor Mycobacterium sp. (strain JLS)
A8L6K4 6e-26 103 31 3 224 3 lexA LexA repressor Parafrankia sp. (strain EAN1pec)
A4TCN9 8.74e-26 102 30 1 195 3 lexA LexA repressor Mycolicibacterium gilvum (strain PYR-GCK)
Q38W54 1.02e-25 101 33 4 206 3 lexA LexA repressor Latilactobacillus sakei subsp. sakei (strain 23K)
A0LUZ1 1.98e-25 102 33 2 212 3 lexA LexA repressor Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B)
Q314F2 2.46e-25 100 34 2 182 3 lexA LexA repressor Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q04F93 3.28e-25 100 33 5 213 3 lexA LexA repressor Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
B1MCZ5 3.83e-25 100 31 2 196 3 lexA LexA repressor Mycobacteroides abscessus (strain ATCC 19977 / DSM 44196 / CCUG 20993 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543 / L948)
Q8FPF5 6.27e-25 100 30 3 225 3 lexA LexA repressor Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
A9BGA3 1.06e-24 99 31 6 206 3 lexA LexA repressor Petrotoga mobilis (strain DSM 10674 / SJ95)
A0QIQ3 1.4e-24 99 31 1 193 3 lexA LexA repressor Mycobacterium avium (strain 104)
Q0RDY1 1.41e-24 100 30 3 226 3 lexA LexA repressor Frankia alni (strain DSM 45986 / CECT 9034 / ACN14a)
Q1IU64 1.69e-24 98 33 5 213 3 lexA LexA repressor Koribacter versatilis (strain Ellin345)
A1SND2 4.1e-24 98 30 2 202 3 lexA LexA repressor Nocardioides sp. (strain ATCC BAA-499 / JS614)
P61612 5.31e-24 97 31 1 193 3 lexA LexA repressor Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
B0RHB3 5.53e-24 97 30 2 214 3 lexA LexA repressor Clavibacter sepedonicus
A0QVY5 6.34e-24 97 31 2 196 3 lexA LexA repressor Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q2J779 1.2e-23 97 29 2 231 3 lexA LexA repressor Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
A0L9E2 1.79e-23 96 35 5 193 3 lexA LexA repressor Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
Q03WX0 1.85e-23 95 30 6 212 3 lexA LexA repressor Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
B2G6T4 2e-23 95 29 3 202 3 lexA LexA repressor Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VJB8 2e-23 95 29 3 202 3 lexA LexA repressor Limosilactobacillus reuteri (strain DSM 20016)
Q6AE10 3.07e-23 95 28 2 212 3 lexA LexA repressor Leifsonia xyli subsp. xyli (strain CTCB07)
A5CSL0 3.34e-23 95 29 2 214 3 lexA LexA repressor Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382)
B0S1C5 3.71e-23 95 29 2 187 3 lexA LexA repressor Finegoldia magna (strain ATCC 29328 / DSM 20472 / WAL 2508)
A1R556 3.78e-23 95 28 3 229 3 lexA LexA repressor Paenarthrobacter aurescens (strain TC1)
A0JUZ2 5e-23 95 29 2 213 3 lexA LexA repressor Arthrobacter sp. (strain FB24)
Q8NP86 7.05e-23 95 29 3 226 3 lexA LexA repressor Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A4QET8 1.45e-22 94 29 3 226 3 lexA LexA repressor Corynebacterium glutamicum (strain R)
Q88VI6 1.76e-22 93 29 4 208 3 lexA LexA repressor Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
B1MZ70 2.27e-22 93 30 5 210 3 lexA LexA repressor Leuconostoc citreum (strain KM20)
A5UQF5 2.73e-22 93 33 6 216 3 lexA LexA repressor Roseiflexus sp. (strain RS-1)
B8HG97 1.61e-21 91 27 2 234 3 lexA LexA repressor Pseudarthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / CIP 107037 / JCM 12360 / KCTC 9906 / NCIMB 13794 / A6)
P0DOW5 1.89e-20 87 33 6 201 1 lexA LexA repressor Verrucomicrobium spinosum (strain ATCC 43997 / DSM 4136 / JCM 18804 / IFAM 1439)
Q5NR31 1.9e-20 88 28 4 217 3 lexA LexA repressor Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
A8F429 2.01e-20 87 34 7 201 3 lexA LexA repressor Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO)
Q163X5 2.69e-20 88 30 6 233 3 lexA LexA repressor Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
A9B5H8 1.02e-19 86 31 7 218 3 lexA LexA repressor Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785 / 114-95)
Q4JV87 1.47e-19 87 28 2 210 3 lexA LexA repressor Corynebacterium jeikeium (strain K411)
P61607 5.92e-19 84 26 3 224 3 lexA LexA repressor Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
Q0APU7 1e-18 84 27 3 230 3 lexA LexA repressor Maricaulis maris (strain MCS10)
Q3SRJ0 1.71e-18 83 25 3 233 3 lexA LexA repressor Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q2IW99 2.41e-18 83 28 6 233 3 lexA LexA repressor Rhodopseudomonas palustris (strain HaA2)
Q89KS7 6.19e-18 82 25 3 231 3 lexA LexA repressor Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q28R71 1.03e-17 81 26 4 228 3 lexA LexA repressor Jannaschia sp. (strain CCS1)
Q1GHJ8 1.11e-17 81 27 5 241 3 lexA LexA repressor Ruegeria sp. (strain TM1040)
B6JG34 1.14e-17 81 25 4 232 3 lexA LexA repressor Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
A5G2J1 1.2e-17 81 27 2 207 3 lexA LexA repressor Acidiphilium cryptum (strain JF-5)
Q1QMK3 1.93e-17 80 25 4 233 3 lexA LexA repressor Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
A4WX64 2.59e-17 80 29 5 228 3 lexA LexA repressor Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Q5LRH4 2.88e-17 80 27 3 231 3 lexA LexA repressor Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
A8I825 4.01e-17 79 25 4 235 3 lexA LexA repressor Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q136C2 4.42e-17 79 25 4 235 3 lexA LexA repressor Rhodopseudomonas palustris (strain BisB5)
A7INJ8 4.76e-17 79 27 5 213 3 lexA LexA repressor Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
P61613 5.54e-17 79 26 5 238 3 lexA LexA repressor Rhodobacter capsulatus
B0SYZ8 9.3e-17 79 24 2 234 3 lexA LexA repressor Caulobacter sp. (strain K31)
Q07NH5 1.07e-16 78 25 4 237 3 lexA LexA repressor Rhodopseudomonas palustris (strain BisA53)
B6IST2 1.09e-16 78 27 4 236 3 lexA LexA repressor Rhodospirillum centenum (strain ATCC 51521 / SW)
Q11HT8 1.14e-16 78 25 3 235 3 lexA LexA repressor Chelativorans sp. (strain BNC1)
Q2NA93 1.27e-16 78 25 4 232 3 lexA LexA repressor Erythrobacter litoralis (strain HTCC2594)
Q9ZFA4 1.76e-16 77 28 5 228 1 lexA LexA repressor Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
P73722 1.82e-16 77 27 6 205 1 lexA Transcription regulator LexA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q9A724 2.29e-16 77 24 2 233 3 lexA LexA repressor Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q6G5D9 2.34e-16 77 22 3 233 3 lexA LexA repressor Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
B8EK86 2.52e-16 77 25 4 236 3 lexA LexA repressor Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
Q215D1 3.08e-16 77 26 3 213 3 lexA LexA repressor Rhodopseudomonas palustris (strain BisB18)
A3PHK4 3.5e-16 77 28 5 228 3 lexA LexA repressor Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
A5VB97 3.73e-16 77 28 4 203 3 lexA LexA repressor Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
A9HJ64 5.62e-16 77 31 4 182 3 lexA LexA repressor Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
A5EK34 6.42e-16 76 25 4 231 3 lexA LexA repressor Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
A4YVE6 7.27e-16 76 25 3 231 3 lexA LexA repressor Bradyrhizobium sp. (strain ORS 278)
A6X0K7 1.34e-15 75 24 4 238 3 lexA LexA repressor Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
A1B3Z0 1.71e-15 75 27 6 233 3 lexA LexA repressor Paracoccus denitrificans (strain Pd 1222)
O32506 3.16e-15 74 41 2 100 3 lexA LexA repressor Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
B2IKM0 3.86e-15 74 24 3 213 3 lexA LexA repressor Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
B3Q6P2 3.96e-15 74 25 4 236 3 lexA LexA repressor Rhodopseudomonas palustris (strain TIE-1)
P61614 3.96e-15 74 25 4 236 3 lexA LexA repressor Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q98MD2 4.61e-15 74 25 4 244 3 lexA LexA repressor Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
B4RBX6 4.99e-15 73 24 3 228 3 lexA LexA repressor Phenylobacterium zucineum (strain HLK1)
Q5FNN8 6.27e-15 73 26 2 214 3 lexA LexA repressor Gluconobacter oxydans (strain 621H)
B0UGH4 6.3e-15 73 24 3 215 3 lexA LexA repressor Methylobacterium sp. (strain 4-46)
B8IN87 9.53e-15 73 24 4 240 3 lexA LexA repressor Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
Q0BTY8 1e-14 73 27 4 216 3 lexA LexA repressor Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
Q8YHG1 1.14e-14 73 24 3 239 3 lexA LexA repressor Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q8G0F1 1.69e-14 72 24 3 239 3 lexA LexA repressor Brucella suis biovar 1 (strain 1330)
B0CGU2 1.69e-14 72 24 3 239 3 lexA LexA repressor Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VQR8 1.69e-14 72 24 3 239 3 lexA LexA repressor Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
C0RJB4 1.69e-14 72 24 3 239 3 lexA LexA repressor Brucella melitensis biotype 2 (strain ATCC 23457)
A9M5F7 1.69e-14 72 24 3 239 3 lexA LexA repressor Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q57CZ5 1.69e-14 72 24 3 239 3 lexA LexA repressor Brucella abortus biovar 1 (strain 9-941)
Q2YRR1 1.69e-14 72 24 3 239 3 lexA LexA repressor Brucella abortus (strain 2308)
B2S5Z4 1.69e-14 72 24 3 239 3 lexA LexA repressor Brucella abortus (strain S19)
Q0C1A3 4.71e-14 71 28 5 203 3 lexA LexA repressor Hyphomonas neptunium (strain ATCC 15444)
B1LUJ7 5.71e-14 71 23 3 218 3 lexA LexA repressor Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
B9JEY4 6.81e-14 71 23 3 238 3 lexA LexA repressor Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
A8LMK0 1.02e-13 70 25 4 231 3 lexA LexA repressor Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
Q2RT47 1.14e-13 70 34 2 124 3 lexA LexA repressor Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
B9JX59 3.28e-13 69 23 3 237 3 lexA LexA repressor Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
B3PYQ7 4.18e-13 68 24 3 237 3 lexA LexA repressor Rhizobium etli (strain CIAT 652)
Q92PW3 4.95e-13 68 24 3 236 3 lexA LexA repressor Rhizobium meliloti (strain 1021)
Q6FZU5 4.98e-13 68 21 3 236 3 lexA LexA repressor Bartonella quintana (strain Toulouse)
B5ZN98 5.01e-13 68 24 3 237 3 lexA LexA repressor Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q1GUX2 5.12e-13 68 25 4 226 3 lexA LexA repressor Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
A6U971 5.37e-13 68 24 3 236 3 lexA LexA repressor Sinorhizobium medicae (strain WSM419)
Q2K8X2 5.95e-13 68 24 3 237 3 lexA LexA repressor Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q1MH39 6.79e-13 68 24 3 237 3 lexA LexA repressor Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q8UFK2 2.4e-12 67 24 4 238 3 lexA LexA repressor Agrobacterium fabrum (strain C58 / ATCC 33970)
Q2W3A5 2.68e-12 66 23 3 234 3 lexA LexA repressor Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q2G6Q5 7.33e-12 65 24 4 233 3 lexA LexA repressor Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
Q4FM55 7.46e-12 65 23 3 225 3 lexA LexA repressor Pelagibacter ubique (strain HTCC1062)
A7HY01 1.49e-11 64 23 3 237 3 lexA LexA repressor Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
P61605 3.33e-10 60 24 4 237 3 lexA LexA repressor Rhizobium radiobacter
P0AG13 8.85e-10 58 31 3 117 3 umuD Protein UmuD Shigella flexneri
P0AG11 8.85e-10 58 31 3 117 1 umuD Protein UmuD Escherichia coli (strain K12)
P0AG12 8.85e-10 58 31 3 117 3 umuD Protein UmuD Escherichia coli O157:H7
P22493 1.29e-09 57 32 3 117 1 umuD Protein UmuD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q7BSM9 6.21e-09 55 36 2 84 3 impA Protein ImpA Shigella flexneri
P18641 6.21e-09 55 36 2 84 3 impA Protein ImpA Salmonella typhimurium
Q5J3U9 6.21e-09 55 36 2 84 3 impA Protein ImpA Salmonella choleraesuis (strain SC-B67)
Q7M1C0 6.21e-09 55 36 2 84 3 None Protein ImpA Escherichia coli
P0A275 1.49e-08 55 40 1 79 3 mucA Protein MucA Salmonella typhimurium
P0A276 1.49e-08 55 40 1 79 3 mucA Protein MucA Escherichia coli
P23831 9.29e-08 52 35 1 80 3 samA Protein SamA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS18575
Feature type CDS
Gene lexA
Product transcriptional repressor LexA
Location 54104 - 54718 (strand: -1)
Length 615 (nucleotides) / 204 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000009
Length 74461 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2453
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00717 Peptidase S24-like
PF01726 LexA DNA binding domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1974 Transcription (K)
Signal transduction mechanisms (T)
KT SOS-response transcriptional repressor LexA (RecA-mediated autopeptidase)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K01356 repressor LexA [EC:3.4.21.88] - -

Protein Sequence

MKALTARQQQVYDLVRDHIAQTGMPPTRAEIAARLGFRSPNAAEEHLKALARKGVIEIISGASRGIRLLMEEEDDAGLPLIGRVAAGEPLLAQEHIESYYQVDPSLFKPSADFLLRVNGMSMKDIGIMDGDLLAVHKTQDVHNGQVVVARIEDEVTVKRFKKVGNKIELHAENAEFSPIVVDLREQSFIVEGLAVGVIRNSDWN

Flanking regions ( +/- flanking 50bp)

AATACCTGTATATACTCACAGCTTGACTGTATAAACAAACAGGGGGCGGAATGAAAGCACTGACGGCACGGCAACAACAGGTATATGACCTGGTACGTGACCATATTGCGCAGACGGGCATGCCACCAACGCGTGCAGAGATTGCGGCCCGCCTGGGTTTTCGCTCTCCGAATGCGGCGGAAGAGCATCTGAAAGCACTGGCGCGTAAAGGCGTAATTGAAATTATCTCGGGAGCATCCCGGGGGATCCGTCTGCTTATGGAAGAAGAAGACGATGCAGGTTTACCTCTGATTGGCCGCGTGGCTGCAGGTGAACCGTTGTTAGCGCAGGAACATATCGAAAGCTATTATCAGGTTGACCCGTCACTCTTTAAACCCAGCGCAGATTTTTTGCTGCGGGTGAATGGCATGTCAATGAAAGATATCGGTATTATGGATGGTGATTTACTTGCGGTGCATAAAACCCAGGACGTGCATAACGGCCAGGTTGTGGTTGCCCGCATTGAAGATGAAGTTACCGTTAAGCGGTTTAAGAAAGTAGGCAATAAAATTGAGCTTCACGCTGAAAATGCAGAGTTCAGCCCGATTGTTGTCGATTTACGGGAACAAAGCTTTATTGTTGAAGGTCTGGCTGTCGGGGTTATCCGTAACAGCGACTGGAACTGATTCAGCGATTGGGATTGGTTAATACGCAAAATCGCTTAAAAAACCACAGC