Homologs in group_2248

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_16920 FBDBKF_16920 76.7 Morganella morganii S1 tatB Sec-independent protein translocase protein TatB
EHELCC_16670 EHELCC_16670 76.7 Morganella morganii S2 tatB Sec-independent protein translocase protein TatB
NLDBIP_16880 NLDBIP_16880 76.7 Morganella morganii S4 tatB Sec-independent protein translocase protein TatB
LHKJJB_16590 LHKJJB_16590 76.7 Morganella morganii S3 tatB Sec-independent protein translocase protein TatB
HKOGLL_17555 HKOGLL_17555 76.7 Morganella morganii S5 tatB Sec-independent protein translocase protein TatB
PMI_RS17595 PMI_RS17595 57.0 Proteus mirabilis HI4320 tatB Sec-independent protein translocase protein TatB

Distribution of the homologs in the orthogroup group_2248

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2248

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7MZ85 1.98e-50 162 57 4 156 3 tatB Sec-independent protein translocase protein TatB Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A1AI26 3.68e-47 154 72 0 97 3 tatB Sec-independent protein translocase protein TatB Escherichia coli O1:K1 / APEC
Q1R473 4.94e-47 154 72 0 97 3 tatB Sec-independent protein translocase protein TatB Escherichia coli (strain UTI89 / UPEC)
Q8FBI7 4.94e-47 154 72 0 97 3 tatB Sec-independent protein translocase protein TatB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TAL7 4.94e-47 154 72 0 97 3 tatB Sec-independent protein translocase protein TatB Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P69427 5.21e-47 154 72 0 97 3 tatB Sec-independent protein translocase protein TatB Shigella flexneri
Q0SZ29 5.21e-47 154 72 0 97 3 tatB Sec-independent protein translocase protein TatB Shigella flexneri serotype 5b (strain 8401)
P69425 5.21e-47 154 72 0 97 1 tatB Sec-independent protein translocase protein TatB Escherichia coli (strain K12)
P69426 5.21e-47 154 72 0 97 3 tatB Sec-independent protein translocase protein TatB Escherichia coli O157:H7
Q6DAQ3 1.5e-45 151 64 1 115 3 tatB Sec-independent protein translocase protein TatB Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
P57048 2.73e-45 150 70 0 96 3 tatB Sec-independent protein translocase protein TatB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z3C0 2.73e-45 150 70 0 96 3 tatB Sec-independent protein translocase protein TatB Salmonella typhi
Q5PKQ9 2.73e-45 150 70 0 96 3 tatB Sec-independent protein translocase protein TatB Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57HN4 2.73e-45 150 70 0 96 3 tatB Sec-independent protein translocase protein TatB Salmonella choleraesuis (strain SC-B67)
Q2NWT7 3e-45 151 61 3 125 3 tatB Sec-independent protein translocase protein TatB Sodalis glossinidius (strain morsitans)
A1JIF6 3.74e-37 130 59 3 149 3 tatB Sec-independent protein translocase protein TatB Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A3N3S4 1.45e-36 128 60 0 93 3 tatB Sec-independent protein translocase protein TatB Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q7VN64 2.8e-36 126 51 3 127 3 tatB Sec-independent protein translocase protein TatB Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q66FS6 5.02e-35 125 75 0 96 3 tatB Sec-independent protein translocase protein TatB Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TR35 5.41e-35 125 75 0 96 3 tatB Sec-independent protein translocase protein TatB Yersinia pestis (strain Pestoides F)
Q1CNB0 5.41e-35 125 75 0 96 3 tatB Sec-independent protein translocase protein TatB Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZAM3 5.41e-35 125 75 0 96 3 tatB Sec-independent protein translocase protein TatB Yersinia pestis
Q1CBF6 5.41e-35 125 75 0 96 3 tatB Sec-independent protein translocase protein TatB Yersinia pestis bv. Antiqua (strain Antiqua)
Q0I206 8.1e-35 123 59 0 93 3 tatB Sec-independent protein translocase protein TatB Histophilus somni (strain 129Pt)
Q65VA2 8.23e-35 124 59 0 93 3 tatB Sec-independent protein translocase protein TatB Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
A1SRS0 7.13e-33 117 44 1 134 3 tatB Sec-independent protein translocase protein TatB Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
A4STK7 3.4e-32 115 53 0 96 3 tatB Sec-independent protein translocase protein TatB Aeromonas salmonicida (strain A449)
Q7MQ29 3.8e-32 115 56 0 96 3 tatB Sec-independent protein translocase protein TatB Vibrio vulnificus (strain YJ016)
Q8DDQ3 3.8e-32 115 56 0 96 3 tatB Sec-independent protein translocase protein TatB Vibrio vulnificus (strain CMCP6)
Q87TH0 2.31e-31 113 51 0 102 3 tatB Sec-independent protein translocase protein TatB Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B0TJ20 1.7e-29 108 43 3 137 3 tatB Sec-independent protein translocase protein TatB Shewanella halifaxensis (strain HAW-EB4)
P57063 1.88e-29 108 53 0 96 3 tatB Sec-independent protein translocase protein TatB Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P57800 2.57e-27 104 61 0 93 3 tatB Sec-independent protein translocase protein TatB Pasteurella multocida (strain Pm70)
P57047 2.04e-25 99 62 0 93 3 tatB Sec-independent protein translocase protein TatB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q4QP03 2.55e-25 99 62 0 93 3 tatB Sec-independent protein translocase protein TatB Haemophilus influenzae (strain 86-028NP)
A0KEG0 1.35e-24 96 54 0 96 3 tatB Sec-independent protein translocase protein TatB Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A8G0T1 2.28e-23 92 55 1 97 3 tatB Sec-independent protein translocase protein TatB Shewanella sediminis (strain HAW-EB3)
B8CI02 2.38e-22 90 54 1 97 3 tatB Sec-independent protein translocase protein TatB Shewanella piezotolerans (strain WP3 / JCM 13877)
Q088I2 3.63e-22 89 54 1 97 3 tatB Sec-independent protein translocase protein TatB Shewanella frigidimarina (strain NCIMB 400)
Q0HZQ1 3.74e-22 90 55 1 97 3 tatB Sec-independent protein translocase protein TatB Shewanella sp. (strain MR-7)
Q0HE97 3.74e-22 90 55 1 97 3 tatB Sec-independent protein translocase protein TatB Shewanella sp. (strain MR-4)
B1KR03 3.96e-22 89 54 1 97 3 tatB Sec-independent protein translocase protein TatB Shewanella woodyi (strain ATCC 51908 / MS32)
A3QIE5 4.05e-22 89 55 1 97 3 tatB Sec-independent protein translocase protein TatB Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q12S27 4.41e-22 89 55 1 97 3 tatB Sec-independent protein translocase protein TatB Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A1RP82 4.73e-22 90 55 1 97 3 tatB Sec-independent protein translocase protein TatB Shewanella sp. (strain W3-18-1)
A4Y2Q1 4.73e-22 90 55 1 97 3 tatB Sec-independent protein translocase protein TatB Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A9KYL4 2.82e-21 88 53 1 97 3 tatB Sec-independent protein translocase protein TatB Shewanella baltica (strain OS195)
A6WIE5 2.82e-21 88 53 1 97 3 tatB Sec-independent protein translocase protein TatB Shewanella baltica (strain OS185)
B8E6B2 3.71e-21 87 53 1 97 3 tatB Sec-independent protein translocase protein TatB Shewanella baltica (strain OS223)
A3D9F6 4.05e-21 87 53 1 97 3 tatB Sec-independent protein translocase protein TatB Shewanella baltica (strain OS155 / ATCC BAA-1091)
A0L1M8 1.03e-20 86 54 1 97 3 tatB Sec-independent protein translocase protein TatB Shewanella sp. (strain ANA-3)
A8H970 1.79e-20 85 51 1 97 3 tatB Sec-independent protein translocase protein TatB Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
Q8E9R3 2.55e-20 85 53 1 97 3 tatB Sec-independent protein translocase protein TatB Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q0VM99 1.44e-18 80 41 7 141 3 tatB Sec-independent protein translocase protein TatB Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q2SN18 1.64e-16 75 50 0 65 3 tatB Sec-independent protein translocase protein TatB Hahella chejuensis (strain KCTC 2396)
A1U673 1.3e-15 73 39 0 86 3 tatB Sec-independent protein translocase protein TatB Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q1Q8C2 2.33e-14 71 35 2 110 3 tatB Sec-independent protein translocase protein TatB Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q4FQ60 2.96e-14 71 33 3 133 3 tatB Sec-independent protein translocase protein TatB Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q1R004 3.89e-14 68 42 0 69 3 tatB Sec-independent protein translocase protein TatB Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q6FER0 1.53e-13 67 35 2 93 3 tatB Sec-independent protein translocase protein TatB Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q2KTS6 5.53e-13 66 33 1 93 3 tatB Sec-independent protein translocase protein TatB Bordetella avium (strain 197N)
A4VGD9 6.38e-13 65 46 0 65 3 tatB Sec-independent protein translocase protein TatB Stutzerimonas stutzeri (strain A1501)
A5EVU3 3e-12 64 32 4 143 3 tatB Sec-independent protein translocase protein TatB Dichelobacter nodosus (strain VCS1703A)
Q5FA50 4.47e-12 65 34 2 109 3 tatB Sec-independent protein translocase protein TatB Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q214X1 4.77e-12 64 28 3 126 3 tatB Sec-independent protein translocase protein TatB Rhodopseudomonas palustris (strain BisB18)
Q5P7A0 8.63e-12 63 37 1 82 3 tatB Sec-independent protein translocase protein TatB Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q9JVK1 9.12e-12 64 33 4 130 3 tatB Sec-independent protein translocase protein TatB Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q9K0J6 9.6e-12 64 33 2 109 3 tatB Sec-independent protein translocase protein TatB Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
A3M1X6 1.02e-11 62 37 2 88 3 tatB Sec-independent protein translocase protein TatB Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
Q21FP7 1.12e-11 63 44 0 63 3 tatB Sec-independent protein translocase protein TatB Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
A1KSK9 1.12e-11 64 33 1 104 3 tatB Sec-independent protein translocase protein TatB Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q3SI72 1.12e-11 62 31 1 98 3 tatB Sec-independent protein translocase protein TatB Thiobacillus denitrificans (strain ATCC 25259)
Q3BMG2 1.5e-11 63 33 5 167 3 tatB Sec-independent protein translocase protein TatB Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q3SRQ2 2.11e-11 62 32 1 97 3 tatB Sec-independent protein translocase protein TatB Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q7VSY1 5.04e-11 60 33 1 93 3 tatB Sec-independent protein translocase protein TatB Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q1QME4 5.56e-11 61 29 6 160 3 tatB Sec-independent protein translocase protein TatB Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q2NXS1 7.63e-11 61 42 1 76 3 tatB Sec-independent protein translocase protein TatB Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q7W2X4 8.36e-11 60 33 1 93 3 tatB Sec-independent protein translocase protein TatB Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q89KZ8 8.6e-11 60 33 2 105 3 tatB Sec-independent protein translocase protein TatB Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q8PEX3 1.03e-10 61 42 1 76 3 tatB Sec-independent protein translocase protein TatB Xanthomonas axonopodis pv. citri (strain 306)
A5EJW1 1.07e-10 60 29 5 142 3 tatB Sec-independent protein translocase protein TatB Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
A4YV72 1.19e-10 60 28 5 146 3 tatB Sec-independent protein translocase protein TatB Bradyrhizobium sp. (strain ORS 278)
Q07N50 2.29e-10 59 25 3 151 3 tatB Sec-independent protein translocase protein TatB Rhodopseudomonas palustris (strain BisA53)
Q0AET6 3.29e-10 58 31 1 91 3 tatB Sec-independent protein translocase protein TatB Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q8P3H9 4.81e-10 59 33 2 115 3 tatB Sec-independent protein translocase protein TatB Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UP02 4.81e-10 59 33 2 115 3 tatB Sec-independent protein translocase protein TatB Xanthomonas campestris pv. campestris (strain 8004)
Q0BSQ0 5.01e-10 58 36 0 83 3 tatB Sec-independent protein translocase protein TatB Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
Q82WN0 5.91e-10 57 34 0 73 3 tatB Sec-independent protein translocase protein TatB Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
A1KAU9 1.34e-09 57 38 0 60 3 tatB Sec-independent protein translocase protein TatB Azoarcus sp. (strain BH72)
Q31E60 2.34e-09 57 38 3 73 3 tatB Sec-independent protein translocase protein TatB Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q2IWG4 2.76e-09 57 33 0 68 3 tatB Sec-independent protein translocase protein TatB Rhodopseudomonas palustris (strain HaA2)
A1TDL8 3.79e-09 55 30 5 142 3 tatB Sec-independent protein translocase protein TatB Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
A0R2D1 4.26e-09 55 35 2 74 3 tatB Sec-independent protein translocase protein TatB Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q2ND29 6.01e-09 55 28 0 75 3 tatB Sec-independent protein translocase protein TatB Erythrobacter litoralis (strain HTCC2594)
A4T8W2 9.92e-09 54 35 2 74 3 tatB Sec-independent protein translocase protein TatB Mycolicibacterium gilvum (strain PYR-GCK)
Q2YAV5 1.07e-08 54 31 3 89 3 tatB Sec-independent protein translocase protein TatB Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q2RTH3 1.07e-08 54 28 0 83 3 tatB Sec-independent protein translocase protein TatB Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q87B79 1.45e-08 54 45 0 68 3 tatB Sec-independent protein translocase protein TatB Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q5YQF7 1.6e-08 53 31 5 147 3 tatB Sec-independent protein translocase protein TatB Nocardia farcinica (strain IFM 10152)
Q9PFU4 2.31e-08 53 58 0 41 3 tatB Sec-independent protein translocase protein TatB Xylella fastidiosa (strain 9a5c)
Q5LQ14 2.83e-08 53 30 3 110 3 tatB Sec-independent protein translocase protein TatB Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q2J6B3 3.66e-08 53 41 1 55 3 tatB Sec-independent protein translocase protein TatB Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
Q13TR6 4.38e-08 53 30 3 116 3 tatB Sec-independent protein translocase protein TatB Paraburkholderia xenovorans (strain LB400)
Q1B4T8 1.7e-07 51 31 2 74 3 tatB Sec-independent protein translocase protein TatB Mycobacterium sp. (strain MCS)
A1UK99 1.7e-07 51 31 2 74 3 tatB Sec-independent protein translocase protein TatB Mycobacterium sp. (strain KMS)
A3Q3Q3 1.7e-07 51 31 2 74 3 tatB Sec-independent protein translocase protein TatB Mycobacterium sp. (strain JLS)
O25700 2.3e-07 51 31 0 60 3 tatB Sec-independent protein translocase protein TatB Helicobacter pylori (strain ATCC 700392 / 26695)
Q1CUB8 2.32e-07 51 31 0 60 3 tatB Sec-independent protein translocase protein TatB Helicobacter pylori (strain HPAG1)
Q8XV90 2.84e-07 51 34 0 73 3 tatB Sec-independent protein translocase protein TatB Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q17WP6 3.27e-07 50 31 0 60 3 tatB Sec-independent protein translocase protein TatB Helicobacter acinonychis (strain Sheeba)
C1AZL6 3.51e-07 50 37 2 74 3 tatB Sec-independent protein translocase protein TatB Rhodococcus opacus (strain B4)
Q9ZM58 4.49e-07 50 28 0 60 3 tatB Sec-independent protein translocase protein TatB Helicobacter pylori (strain J99 / ATCC 700824)
A1WFS5 4.88e-07 50 27 2 102 3 tatB Sec-independent protein translocase protein TatB Verminephrobacter eiseniae (strain EF01-2)
A2SE15 6.01e-07 50 29 1 93 3 tatB Sec-independent protein translocase protein TatB Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
Q5HVJ1 8.17e-07 49 25 2 97 3 tatB Sec-independent protein translocase protein TatB Campylobacter jejuni (strain RM1221)
Q9PHT7 8.17e-07 49 25 2 97 3 tatB Sec-independent protein translocase protein TatB Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q7VG35 4.22e-06 48 24 4 151 3 tatB Sec-independent protein translocase protein TatB Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q1GFN7 4.79e-06 47 26 3 113 3 tatB Sec-independent protein translocase protein TatB Ruegeria sp. (strain TM1040)
Q46WM4 4.82e-06 47 34 0 70 3 tatB Sec-independent protein translocase protein TatB Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q0K699 6.34e-06 47 34 0 70 3 tatB Sec-independent protein translocase protein TatB Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q62GF1 7.58e-06 47 26 4 172 3 tatB Sec-independent protein translocase protein TatB Burkholderia mallei (strain ATCC 23344)
Q1LIB8 8.35e-06 47 34 0 70 3 tatB Sec-independent protein translocase protein TatB Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q21U85 8.59e-06 47 36 1 68 3 tatB Sec-independent protein translocase protein TatB Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q63Q98 1.09e-05 47 26 6 179 3 tatB Sec-independent protein translocase protein TatB Burkholderia pseudomallei (strain K96243)
A3P021 1.09e-05 47 26 6 179 3 tatB Sec-independent protein translocase protein TatB Burkholderia pseudomallei (strain 1106a)
A0RPZ4 1.1e-05 46 28 4 134 3 tatB Sec-independent protein translocase protein TatB Campylobacter fetus subsp. fetus (strain 82-40)
Q2SUB4 1.2e-05 47 24 3 172 3 tatB Sec-independent protein translocase protein TatB Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q163T8 1.6e-05 46 26 3 97 3 tatB Sec-independent protein translocase protein TatB Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q3JN08 1.93e-05 46 26 7 173 3 tatB Sec-independent protein translocase protein TatB Burkholderia pseudomallei (strain 1710b)
B8GX56 2.56e-05 46 29 2 77 3 tatB Sec-independent protein translocase protein TatB Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A6T1 2.56e-05 46 29 2 77 3 tatB Sec-independent protein translocase protein TatB Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
A4F8J0 2.7e-05 45 40 1 55 3 tatB Sec-independent protein translocase protein TatB Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
A4G9I1 2.75e-05 45 27 1 93 3 tatB Sec-independent protein translocase protein TatB Herminiimonas arsenicoxydans
A1TL13 2.85e-05 45 27 1 86 3 tatB Sec-independent protein translocase protein TatB Paracidovorax citrulli (strain AAC00-1)
Q0BIV8 3.32e-05 45 31 1 88 3 tatB Sec-independent protein translocase protein TatB Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q8FQD9 3.81e-05 45 26 3 113 3 tatB Sec-independent protein translocase protein TatB Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q1BS37 4.34e-05 45 31 1 88 3 tatB Sec-independent protein translocase protein TatB Burkholderia orbicola (strain AU 1054)
A0K3W4 4.34e-05 45 31 1 88 3 tatB Sec-independent protein translocase protein TatB Burkholderia cenocepacia (strain HI2424)
Q12FC1 5.23e-05 45 32 1 68 3 tatB Sec-independent protein translocase protein TatB Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q39K79 5.5e-05 45 31 1 88 3 tatB Sec-independent protein translocase protein TatB Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q4JUF6 5.53e-05 45 24 7 186 3 tatB Sec-independent protein translocase protein TatB Corynebacterium jeikeium (strain K411)
A1W451 6.06e-05 44 32 1 68 3 tatB Sec-independent protein translocase protein TatB Acidovorax sp. (strain JS42)
A1VK48 0.000141 43 33 1 68 3 tatB Sec-independent protein translocase protein TatB Polaromonas naphthalenivorans (strain CJ2)
B0T1Q6 0.000142 43 28 1 69 3 tatB Sec-independent protein translocase protein TatB Caulobacter sp. (strain K31)
Q110N2 0.000308 41 28 1 64 3 tatA Sec-independent protein translocase protein TatA Trichodesmium erythraeum (strain IMS101)
C4LIK7 0.000477 40 34 0 49 3 tatA Sec-independent protein translocase protein TatA Corynebacterium kroppenstedtii (strain DSM 44385 / JCM 11950 / CIP 105744 / CCUG 35717)
A3PB74 0.000634 40 24 0 77 3 tatA Sec-independent protein translocase protein TatA Prochlorococcus marinus (strain MIT 9301)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS18390
Feature type CDS
Gene tatB
Product Sec-independent protein translocase protein TatB
Location 12572 - 13108 (strand: -1)
Length 537 (nucleotides) / 178 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000009
Length 74461 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2248
Orthogroup size 7
N. genomes 7

Actions

Genomic region

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1826 Intracellular trafficking, secretion, and vesicular transport (U) U Twin-arginine protein secretion pathway components TatA and TatB

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03117 sec-independent protein translocase protein TatB Protein export
Bacterial secretion system
-

Protein Sequence

MFDIGFGELILVMVIGLVVLGPERLPVAVKTVAGWVRVLRSMAANVQNELTQELKLQELQDNLKKMEEQAGTIISPELKASMDELKGAADTLRRSYLEPVDSLKKQLDPEALADRELDLSAINSAPSPSADKPSADSPAPVTLTKIPDAQVPVSPAPVVNETEHTPLSVSPVSDSQKH

Flanking regions ( +/- flanking 50bp)

CTGACTCGTCTGAACAGTCTGAGAATAAAAACAAAGAGCAGGTATAACCCGTGTTTGACATCGGTTTTGGTGAACTGATTTTAGTAATGGTCATCGGGCTTGTTGTTCTGGGGCCGGAACGCCTTCCGGTTGCTGTGAAAACAGTCGCCGGCTGGGTTCGTGTTTTACGCTCAATGGCTGCCAATGTGCAGAATGAGCTTACCCAGGAACTGAAACTTCAGGAATTGCAGGATAATCTGAAGAAGATGGAAGAGCAGGCCGGTACCATTATTTCACCTGAATTGAAGGCGTCGATGGATGAGCTGAAAGGGGCTGCGGATACACTGCGCCGATCTTATCTGGAGCCGGTGGATTCTCTGAAAAAACAGCTTGATCCGGAAGCCCTGGCTGACAGGGAACTCGATCTTTCTGCGATTAATTCAGCGCCGTCACCTTCTGCTGACAAACCGTCTGCGGATAGCCCTGCTCCGGTGACACTGACGAAGATACCTGATGCGCAAGTGCCGGTTTCTCCGGCTCCGGTGGTAAATGAAACGGAACATACACCGTTATCTGTATCTCCGGTGTCAGATTCACAGAAACATTAAATGATTATGGTAAAAGCATGTTATGGCTGTTGAAGAAACGCAACCGCTGA