Homologs in group_3716

Help

2 homologs were identified in 2 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
F4V73_RS00350 F4V73_RS00350 38.4 Morganella psychrotolerans - helix-turn-helix domain-containing protein
PMI_RS17395 PMI_RS17395 39.3 Proteus mirabilis HI4320 - ImmA/IrrE family metallo-endopeptidase

Distribution of the homologs in the orthogroup group_3716

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3716

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P67703 6.56e-31 110 44 1 120 1 higA Antitoxin HigA Shigella flexneri
P67701 6.56e-31 110 44 1 120 1 higA Antitoxin HigA Escherichia coli (strain K12)
P67702 6.56e-31 110 44 1 120 3 higA Antitoxin HigA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS18325
Feature type CDS
Gene -
Product helix-turn-helix domain-containing protein
Location 103236 - 103661 (strand: -1)
Length 426 (nucleotides) / 141 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000008
Length 103951 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3716
Orthogroup size 3
N. genomes 2

Actions

Genomic region

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG5499 Defense mechanisms (V) V Antitoxin component HigA of the HigAB toxin-antitoxin module, contains an N-terminal HTH domain

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K18831 HTH-type transcriptional regulator / antitoxin HigA - -

Protein Sequence

MNTIIQKNAIAAMNSVMQSIPFLGGDSSEQAYREALVFVEYLIENDESSPLIDLLTIKIQDYENAGEKFTAFQKEVDDIPTGVAALKVLMEQHGLKYTDLFNEIGSKSLVSLIMSGKRMLTVGHIKALSARFHVKPELFFS

Flanking regions ( +/- flanking 50bp)

ACCCACAAGGAATATGACCAGTTAACGAAATACTACCGGGAAAACAAAGAATGAATACTATCATCCAAAAGAACGCCATTGCCGCAATGAACAGTGTCATGCAGTCAATACCGTTTCTCGGCGGGGACAGCTCAGAACAAGCCTATCGTGAGGCACTGGTTTTCGTTGAATACCTGATCGAAAACGACGAATCAAGCCCGCTGATTGATCTGCTGACTATCAAAATTCAGGACTATGAAAACGCAGGTGAGAAATTCACTGCATTCCAGAAAGAGGTCGATGATATCCCTACGGGCGTGGCTGCGCTGAAAGTATTAATGGAGCAGCATGGCCTGAAATACACTGACCTTTTTAATGAGATTGGTTCTAAATCTCTGGTCAGCCTGATCATGTCAGGTAAACGTATGCTGACTGTAGGGCACATCAAAGCCTTATCTGCCCGGTTCCATGTAAAGCCGGAACTGTTTTTCTCCTGATACACACAATCAGATAAAGGCGACCACCGGTTGCCTTTACATACCCACCT