Homologs in group_192

Help

8 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_17380 FBDBKF_17380 35.6 Morganella morganii S1 ribD bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD
EHELCC_17275 EHELCC_17275 35.6 Morganella morganii S2 ribD bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD
NLDBIP_17920 NLDBIP_17920 35.6 Morganella morganii S4 ribD bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD
LHKJJB_17840 LHKJJB_17840 35.6 Morganella morganii S3 ribD bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD
HKOGLL_17850 HKOGLL_17850 35.6 Morganella morganii S5 ribD bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD
F4V73_RS02875 F4V73_RS02875 29.8 Morganella psychrotolerans - anti-phage dCTP deaminase
F4V73_RS16555 F4V73_RS16555 37.3 Morganella psychrotolerans ribD bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD
PMI_RS00390 PMI_RS00390 42.9 Proteus mirabilis HI4320 ribD bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD

Distribution of the homologs in the orthogroup group_192

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_192

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P16006 4.47e-38 131 40 4 174 1 CD Deoxycytidylate deaminase Enterobacteria phage T4
P00814 4.86e-35 123 38 4 173 1 CD Deoxycytidylate deaminase Enterobacteria phage T2
P32321 5.95e-16 73 37 6 125 1 DCTD Deoxycytidylate deaminase Homo sapiens
Q5M9G0 6.9e-16 73 37 6 125 2 Dctd Deoxycytidylate deaminase Rattus norvegicus
Q8K2D6 6.9e-16 73 37 6 125 2 Dctd Deoxycytidylate deaminase Mus musculus
Q5RC69 7.2e-16 73 37 6 125 2 DCTD Deoxycytidylate deaminase Pongo abelii
O43012 5.74e-15 73 32 5 152 3 SPBC2G2.13c Deoxycytidylate deaminase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P30648 1.15e-14 70 36 6 135 3 ZK643.2 Probable deoxycytidylate deaminase Caenorhabditis elegans
P32393 1.94e-14 70 33 2 124 3 comEB ComE operon protein 2 Bacillus subtilis (strain 168)
P33968 4.76e-14 68 32 4 149 3 None Uncharacterized deaminase in luxG 3'region Aliivibrio fischeri
Q9VWA2 6.09e-14 68 33 5 126 2 CG6951 Probable deoxycytidylate deaminase Drosophila melanogaster
P06773 1.2e-12 67 34 2 121 1 DCD1 Deoxycytidylate deaminase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
O22000 3.52e-12 62 33 4 125 3 36.1 Deoxycytidylate deaminase Mycobacterium phage D29
Q8K9A4 4.61e-07 49 36 4 83 3 ribD1 Diaminohydroxyphosphoribosylamino-pyrimidine deaminase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P57533 1.79e-06 48 37 4 81 3 ribD1 Diaminohydroxyphosphoribosylamino-pyrimidine deaminase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
A9CK16 8.75e-06 46 26 6 147 1 tadA tRNA-specific adenosine deaminase Agrobacterium fabrum (strain C58 / ATCC 33970)
P25539 7.27e-05 45 31 2 102 1 ribD Riboflavin biosynthesis protein RibD Escherichia coli (strain K12)
P50853 8.2e-05 44 32 4 107 3 ribD Riboflavin biosynthesis protein RibD Actinobacillus pleuropneumoniae
O24750 0.000105 44 37 1 56 3 ribD Riboflavin biosynthesis protein RibD Corynebacterium ammoniagenes
P17618 0.000141 43 27 6 129 1 ribD Riboflavin biosynthesis protein RibD Bacillus subtilis (strain 168)
P70814 0.000335 43 36 5 84 3 ribD Riboflavin biosynthesis protein RibD Bacillus amyloliquefaciens
Q8TWU6 0.000446 42 32 2 68 1 MK0935 tRNA(cytosine(8)) deaminase Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
Q89AB0 0.000623 42 35 3 73 3 ribD Riboflavin biosynthesis protein RibD Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q5SI38 0.001 42 46 0 41 3 tilS tRNA(Ile)-lysidine synthase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q72IF6 0.001 42 46 0 41 3 tilS tRNA(Ile)-lysidine synthase Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS17810
Feature type CDS
Gene -
Product deaminase
Location 9529 - 9984 (strand: -1)
Length 456 (nucleotides) / 151 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000008
Length 103951 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_192
Orthogroup size 9
N. genomes 7

Actions

Genomic region

Domains

PF00383 Cytidine and deoxycytidylate deaminase zinc-binding region

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2131 Nucleotide transport and metabolism (F) F Deoxycytidylate deaminase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K01493 dCMP deaminase [EC:3.5.4.12] Pyrimidine metabolism
Metabolic pathways
Nucleotide metabolism		 -

Protein Sequence

MKFKPETLMDMAVLVSRESKCVKYQVGCVIEKDGRIIATGCNGTPAGALNCCDVSASKGWDMSKSADRLKHREWSDVNEIHAEMNAVMTASESVKGANVYVTVEPCNQCAKNLVQAGVKSVTFIQSKSGSGVFMSKHGVSVYGIKTCLLIG

Flanking regions ( +/- flanking 50bp)

ATGTGTAATCGTGCCGCAGATGCGTGTGAAAGATTGTTAAAGGTGCAGCAATGAAGTTCAAGCCAGAAACTCTGATGGATATGGCGGTACTGGTATCACGCGAATCAAAGTGCGTTAAGTATCAGGTTGGCTGTGTTATCGAGAAAGACGGCAGGATTATCGCCACCGGCTGCAATGGAACGCCAGCCGGTGCGTTAAACTGCTGTGATGTATCAGCGTCGAAAGGCTGGGATATGTCAAAATCAGCAGACCGGCTCAAGCATCGTGAATGGTCGGATGTGAACGAGATCCACGCAGAAATGAACGCCGTCATGACAGCCAGCGAAAGCGTCAAAGGCGCGAACGTTTATGTCACCGTCGAGCCGTGTAACCAGTGTGCGAAAAATCTTGTCCAAGCGGGTGTAAAGTCGGTCACATTTATTCAGTCAAAAAGCGGCAGTGGTGTGTTTATGAGTAAGCATGGCGTTAGTGTATATGGTATAAAAACATGTTTGTTAATTGGTTAATCCGCTAGTATTATTTTTGTGAATTTATAATAACTTTGAGGTAATTATGA