Homologs in group_2072

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_15495 FBDBKF_15495 98.3 Morganella morganii S1 atpD F0F1 ATP synthase subunit beta
EHELCC_15855 EHELCC_15855 98.3 Morganella morganii S2 atpD F0F1 ATP synthase subunit beta
NLDBIP_16515 NLDBIP_16515 98.3 Morganella morganii S4 atpD F0F1 ATP synthase subunit beta
LHKJJB_16290 LHKJJB_16290 98.3 Morganella morganii S3 atpD F0F1 ATP synthase subunit beta
HKOGLL_16060 HKOGLL_16060 98.3 Morganella morganii S5 atpD F0F1 ATP synthase subunit beta
PMI_RS15175 PMI_RS15175 96.3 Proteus mirabilis HI4320 atpD F0F1 ATP synthase subunit beta

Distribution of the homologs in the orthogroup group_2072

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2072

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4F0E7 0 904 96 0 460 3 atpD ATP synthase subunit beta Proteus mirabilis (strain HI4320)
Q7NA94 0 896 95 0 460 3 atpD ATP synthase subunit beta Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A8G7M8 0 883 93 0 460 3 atpD ATP synthase subunit beta Serratia proteamaculans (strain 568)
B5RFW3 0 883 93 0 460 3 atpD ATP synthase subunit beta Salmonella gallinarum (strain 287/91 / NCTC 13346)
Q6CYJ5 0 882 93 0 460 3 atpD ATP synthase subunit beta Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
B1JRN2 0 881 93 0 460 3 atpD ATP synthase subunit beta Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q663Q8 0 881 93 0 460 3 atpD ATP synthase subunit beta Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TSJ3 0 881 93 0 460 3 atpD ATP synthase subunit beta Yersinia pestis (strain Pestoides F)
Q1CCH5 0 881 93 0 460 3 atpD ATP synthase subunit beta Yersinia pestis bv. Antiqua (strain Nepal516)
A9R5T9 0 881 93 0 460 3 atpD ATP synthase subunit beta Yersinia pestis bv. Antiqua (strain Angola)
Q7CFM8 0 881 93 0 460 3 atpD ATP synthase subunit beta Yersinia pestis
B2K847 0 881 93 0 460 3 atpD ATP synthase subunit beta Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C095 0 881 93 0 460 3 atpD ATP synthase subunit beta Yersinia pestis bv. Antiqua (strain Antiqua)
A7FPE0 0 881 93 0 460 3 atpD ATP synthase subunit beta Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A8A6J5 0 881 93 0 460 3 atpD ATP synthase subunit beta Escherichia coli O9:H4 (strain HS)
Q3YVN6 0 881 93 0 460 3 atpD ATP synthase subunit beta Shigella sonnei (strain Ss046)
P0ABB7 0 881 93 0 460 3 atpD ATP synthase subunit beta Shigella flexneri
Q0SYU4 0 881 93 0 460 3 atpD ATP synthase subunit beta Shigella flexneri serotype 5b (strain 8401)
Q31UN2 0 881 93 0 460 3 atpD ATP synthase subunit beta Shigella boydii serotype 4 (strain Sb227)
B2TUP3 0 881 93 0 460 3 atpD ATP synthase subunit beta Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q7CPE2 0 881 93 0 460 3 atpD ATP synthase subunit beta Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XGX4 0 881 93 0 460 3 atpD ATP synthase subunit beta Salmonella typhi
B4TN31 0 881 93 0 460 3 atpD ATP synthase subunit beta Salmonella schwarzengrund (strain CVM19633)
C0Q2N2 0 881 93 0 460 3 atpD ATP synthase subunit beta Salmonella paratyphi C (strain RKS4594)
A9MXA6 0 881 93 0 460 3 atpD ATP synthase subunit beta Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4SYD1 0 881 93 0 460 3 atpD ATP synthase subunit beta Salmonella newport (strain SL254)
B4TAX2 0 881 93 0 460 3 atpD ATP synthase subunit beta Salmonella heidelberg (strain SL476)
B5QUS4 0 881 93 0 460 3 atpD ATP synthase subunit beta Salmonella enteritidis PT4 (strain P125109)
B5FN33 0 881 93 0 460 3 atpD ATP synthase subunit beta Salmonella dublin (strain CT_02021853)
Q57HX9 0 881 93 0 460 3 atpD ATP synthase subunit beta Salmonella choleraesuis (strain SC-B67)
A9MJR9 0 881 93 0 460 3 atpD ATP synthase subunit beta Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5EYZ6 0 881 93 0 460 3 atpD ATP synthase subunit beta Salmonella agona (strain SL483)
B7LK77 0 881 93 0 460 3 atpD ATP synthase subunit beta Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1R4K2 0 881 93 0 460 3 atpD ATP synthase subunit beta Escherichia coli (strain UTI89 / UPEC)
B1LL59 0 881 93 0 460 3 atpD ATP synthase subunit beta Escherichia coli (strain SMS-3-5 / SECEC)
B6I3W9 0 881 93 0 460 3 atpD ATP synthase subunit beta Escherichia coli (strain SE11)
B7NF48 0 881 93 0 460 3 atpD ATP synthase subunit beta Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0ABB4 0 881 93 0 460 1 atpD ATP synthase subunit beta Escherichia coli (strain K12)
B1IX06 0 881 93 0 460 3 atpD ATP synthase subunit beta Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0ABB5 0 881 93 0 460 3 atpD ATP synthase subunit beta Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TAX7 0 881 93 0 460 3 atpD ATP synthase subunit beta Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AHR4 0 881 93 0 460 3 atpD ATP synthase subunit beta Escherichia coli O1:K1 / APEC
B1X9W0 0 881 93 0 460 3 atpD ATP synthase subunit beta Escherichia coli (strain K12 / DH10B)
C4ZZ10 0 881 93 0 460 3 atpD ATP synthase subunit beta Escherichia coli (strain K12 / MC4100 / BW2952)
B7M588 0 881 93 0 460 3 atpD ATP synthase subunit beta Escherichia coli O8 (strain IAI1)
B7N2H1 0 881 93 0 460 3 atpD ATP synthase subunit beta Escherichia coli O81 (strain ED1a)
B7NR34 0 881 93 0 460 3 atpD ATP synthase subunit beta Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YXD6 0 881 93 0 460 3 atpD ATP synthase subunit beta Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0ABB6 0 881 93 0 460 3 atpD ATP synthase subunit beta Escherichia coli O157:H7
B7L882 0 881 93 0 460 3 atpD ATP synthase subunit beta Escherichia coli (strain 55989 / EAEC)
B7MGF2 0 881 93 0 460 3 atpD ATP synthase subunit beta Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UMJ7 0 881 93 0 460 3 atpD ATP synthase subunit beta Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZTU4 0 881 93 0 460 3 atpD ATP synthase subunit beta Escherichia coli O139:H28 (strain E24377A / ETEC)
C6DJH2 0 880 93 0 460 3 atpD ATP synthase subunit beta Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q329S1 0 879 92 0 460 3 atpD ATP synthase subunit beta Shigella dysenteriae serotype 1 (strain Sd197)
A7MMW9 0 879 93 0 460 3 atpD ATP synthase subunit beta Cronobacter sakazakii (strain ATCC BAA-894)
B5BIN6 0 879 92 0 460 3 atpD ATP synthase subunit beta Salmonella paratyphi A (strain AKU_12601)
Q5PKX2 0 879 92 0 460 3 atpD ATP synthase subunit beta Salmonella paratyphi A (strain ATCC 9150 / SARB42)
A8ACN6 0 878 92 0 460 3 atpD ATP synthase subunit beta Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A1JTC6 0 877 93 0 460 3 atpD ATP synthase subunit beta Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A4WGF5 0 877 92 0 460 3 atpD ATP synthase subunit beta Enterobacter sp. (strain 638)
B5XZM4 0 876 92 0 460 3 atpD ATP synthase subunit beta Klebsiella pneumoniae (strain 342)
A6TG36 0 874 92 0 460 3 atpD ATP synthase subunit beta Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
C5BF40 0 874 92 0 460 3 atpD ATP synthase subunit beta Edwardsiella ictaluri (strain 93-146)
Q2NQ86 0 865 91 0 460 3 atpD ATP synthase subunit beta Sodalis glossinidius (strain morsitans)
B2VCA4 0 858 90 0 460 3 atpD ATP synthase subunit beta Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q0I5X3 0 845 89 1 460 3 atpD ATP synthase subunit beta Histophilus somni (strain 129Pt)
B0UWG5 0 845 89 1 460 3 atpD ATP synthase subunit beta Histophilus somni (strain 2336)
Q9CKW1 0 840 88 1 460 3 atpD ATP synthase subunit beta Pasteurella multocida (strain Pm70)
A5UA11 0 838 88 1 460 3 atpD ATP synthase subunit beta Haemophilus influenzae (strain PittEE)
A6VL57 0 838 88 1 460 3 atpD ATP synthase subunit beta Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
P43715 0 837 88 1 460 3 atpD ATP synthase subunit beta Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q4QN64 0 837 88 1 460 3 atpD ATP synthase subunit beta Haemophilus influenzae (strain 86-028NP)
A5UGY9 0 836 88 1 460 3 atpD ATP synthase subunit beta Haemophilus influenzae (strain PittGG)
Q65Q07 0 835 88 1 460 3 atpD ATP synthase subunit beta Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
B3H2P3 0 833 88 1 460 3 atpD ATP synthase subunit beta Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N2U4 0 833 88 1 460 3 atpD ATP synthase subunit beta Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q7VPP0 0 832 87 1 460 3 atpD ATP synthase subunit beta Haemophilus ducreyi (strain 35000HP / ATCC 700724)
B0BRX2 0 830 87 1 460 3 atpD ATP synthase subunit beta Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B4RS81 0 816 86 1 460 3 atpD ATP synthase subunit beta Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
B8F774 0 815 86 1 460 3 atpD ATP synthase subunit beta Glaesserella parasuis serovar 5 (strain SH0165)
A6W3S8 0 813 85 2 460 3 atpD2 ATP synthase subunit beta 2 Marinomonas sp. (strain MWYL1)
A0KQX8 0 813 85 1 462 3 atpD ATP synthase subunit beta Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A4STP3 0 811 85 1 462 3 atpD ATP synthase subunit beta Aeromonas salmonicida (strain A449)
Q5QZI6 0 807 85 1 461 3 atpD ATP synthase subunit beta Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q15MU4 0 807 85 1 461 3 atpD2 ATP synthase subunit beta 2 Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
C4LDW0 0 803 84 2 462 3 atpD ATP synthase subunit beta Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q48AW0 0 802 84 1 461 3 atpD ATP synthase subunit beta Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q12HQ1 0 800 84 1 461 3 atpD ATP synthase subunit beta Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A0L2S8 0 798 84 2 464 3 atpD ATP synthase subunit beta Shewanella sp. (strain ANA-3)
Q5WSG8 0 798 84 1 460 3 atpD ATP synthase subunit beta Legionella pneumophila (strain Lens)
Q5ZRA1 0 798 84 1 460 3 atpD ATP synthase subunit beta Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A5III3 0 798 84 1 460 3 atpD ATP synthase subunit beta Legionella pneumophila (strain Corby)
Q5X0P3 0 798 84 1 460 3 atpD ATP synthase subunit beta Legionella pneumophila (strain Paris)
Q1LTV4 0 798 83 0 456 3 atpD ATP synthase subunit beta Baumannia cicadellinicola subsp. Homalodisca coagulata
Q8E8C0 0 798 84 2 464 3 atpD ATP synthase subunit beta Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
B0TQF4 0 797 84 1 459 3 atpD ATP synthase subunit beta Shewanella halifaxensis (strain HAW-EB4)
Q3J6N1 0 797 84 1 460 3 atpD ATP synthase subunit beta Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q0HPG1 0 797 84 2 464 3 atpD ATP synthase subunit beta Shewanella sp. (strain MR-7)
Q0HD79 0 797 84 1 461 3 atpD ATP synthase subunit beta Shewanella sp. (strain MR-4)
Q60CR4 0 796 83 1 460 3 atpD ATP synthase subunit beta Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
B1KQ34 0 795 84 1 459 3 atpD ATP synthase subunit beta Shewanella woodyi (strain ATCC 51908 / MS32)
A1WZT1 0 795 83 1 460 3 atpD ATP synthase subunit beta Halorhodospira halophila (strain DSM 244 / SL1)
A9KX06 0 795 84 2 464 3 atpD ATP synthase subunit beta Shewanella baltica (strain OS195)
A6WUJ0 0 795 84 2 464 3 atpD ATP synthase subunit beta Shewanella baltica (strain OS185)
A3DAR4 0 795 84 2 464 3 atpD ATP synthase subunit beta Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8EDV0 0 795 84 2 464 3 atpD ATP synthase subunit beta Shewanella baltica (strain OS223)
Q3IK50 0 794 84 1 461 3 atpD ATP synthase subunit beta Pseudoalteromonas translucida (strain TAC 125)
A1RQB0 0 794 84 1 461 3 atpD ATP synthase subunit beta Shewanella sp. (strain W3-18-1)
A4YCH8 0 794 84 1 461 3 atpD ATP synthase subunit beta Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A4VS62 0 791 83 1 460 3 atpD ATP synthase subunit beta Stutzerimonas stutzeri (strain A1501)
Q9HT20 0 791 84 2 460 3 atpD ATP synthase subunit beta Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02DF4 0 791 84 2 460 3 atpD ATP synthase subunit beta Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V791 0 791 84 2 460 3 atpD ATP synthase subunit beta Pseudomonas aeruginosa (strain LESB58)
A6VF32 0 791 84 2 460 3 atpD ATP synthase subunit beta Pseudomonas aeruginosa (strain PA7)
Q07VU4 0 791 83 1 461 3 atpD1 ATP synthase subunit beta 1 Shewanella frigidimarina (strain NCIMB 400)
Q07232 0 789 81 1 463 3 atpD ATP synthase subunit beta Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
A8HAG3 0 788 83 1 459 3 atpD ATP synthase subunit beta Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
A4Y187 0 787 83 1 460 3 atpD ATP synthase subunit beta Pseudomonas mendocina (strain ymp)
B8D6S7 0 787 81 1 465 3 atpD ATP synthase subunit beta Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57124 0 787 81 1 465 3 atpD ATP synthase subunit beta Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D8H3 0 787 81 1 465 3 atpD ATP synthase subunit beta Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
A8G1W5 0 786 84 1 459 3 atpD ATP synthase subunit beta Shewanella sediminis (strain HAW-EB3)
B8CVU5 0 786 83 1 459 3 atpD ATP synthase subunit beta Shewanella piezotolerans (strain WP3 / JCM 13877)
C1D5G2 0 785 83 1 460 3 atpD ATP synthase subunit beta Laribacter hongkongensis (strain HLHK9)
B8GRB8 0 784 81 1 460 3 atpD ATP synthase subunit beta Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q0VKX4 0 782 82 2 459 3 atpD ATP synthase subunit beta Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
A1SBU0 0 782 82 2 464 3 atpD ATP synthase subunit beta Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q1QSD0 0 782 82 1 458 3 atpD ATP synthase subunit beta Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
B3PIS7 0 781 82 1 460 3 atpD ATP synthase subunit beta Cellvibrio japonicus (strain Ueda107)
Q4ZL24 0 780 82 1 460 3 atpD ATP synthase subunit beta Pseudomonas syringae pv. syringae (strain B728a)
Q87TT4 0 780 82 1 460 3 atpD ATP synthase subunit beta Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q0A4M8 0 780 82 1 460 3 atpD ATP synthase subunit beta Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
A3QJR0 0 779 82 1 459 3 atpD ATP synthase subunit beta Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q4K3A9 0 779 82 1 460 3 atpD ATP synthase subunit beta Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q48BG5 0 779 82 1 460 3 atpD ATP synthase subunit beta Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
B1JFU1 0 778 82 2 460 3 atpD ATP synthase subunit beta Pseudomonas putida (strain W619)
Q3K441 0 778 82 1 460 3 atpD ATP synthase subunit beta Pseudomonas fluorescens (strain Pf0-1)
C3K1E6 0 778 82 1 460 3 atpD ATP synthase subunit beta Pseudomonas fluorescens (strain SBW25)
Q2S6P1 0 774 82 1 459 3 atpD ATP synthase subunit beta Hahella chejuensis (strain KCTC 2396)
C3LSI9 0 773 79 1 467 3 atpD ATP synthase subunit beta Vibrio cholerae serotype O1 (strain M66-2)
Q9KNH5 0 773 79 1 467 3 atpD ATP synthase subunit beta Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F459 0 773 79 1 467 3 atpD ATP synthase subunit beta Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
B0KRA8 0 773 81 1 460 3 atpD ATP synthase subunit beta Pseudomonas putida (strain GB-1)
A1AXU2 0 772 82 1 459 3 atpD ATP synthase subunit beta Ruthia magnifica subsp. Calyptogena magnifica
Q494C3 0 772 80 1 462 3 atpD ATP synthase subunit beta Blochmanniella pennsylvanica (strain BPEN)
Q2YCA3 0 772 82 2 460 3 atpD1 ATP synthase subunit beta 1 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q1I2I7 0 771 81 1 460 3 atpD ATP synthase subunit beta Pseudomonas entomophila (strain L48)
Q7MGI0 0 771 79 1 467 3 atpD ATP synthase subunit beta Vibrio vulnificus (strain YJ016)
Q8DDG8 0 771 79 1 467 3 atpD ATP synthase subunit beta Vibrio vulnificus (strain CMCP6)
Q88BX4 0 770 81 1 460 3 atpD ATP synthase subunit beta Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5WBA3 0 770 81 1 460 3 atpD ATP synthase subunit beta Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q6LLG8 0 768 79 3 469 3 atpD1 ATP synthase subunit beta 1 Photobacterium profundum (strain SS9)
B4SJR9 0 768 79 2 466 3 atpD ATP synthase subunit beta Stenotrophomonas maltophilia (strain R551-3)
Q0AJB0 0 767 82 2 457 3 atpD1 ATP synthase subunit beta 1 Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
B6EHG4 0 767 79 1 467 3 atpD ATP synthase subunit beta Aliivibrio salmonicida (strain LFI1238)
A5CVI6 0 766 81 1 459 3 atpD ATP synthase subunit beta Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
Q7P095 0 764 80 2 466 3 atpD ATP synthase subunit beta Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
A7N0Y1 0 764 78 1 467 3 atpD1 ATP synthase subunit beta 1 Vibrio campbellii (strain ATCC BAA-1116)
C5BKJ5 0 764 80 2 462 3 atpD ATP synthase subunit beta Teredinibacter turnerae (strain ATCC 39867 / T7901)
B5FCZ1 0 763 79 1 467 3 atpD ATP synthase subunit beta Aliivibrio fischeri (strain MJ11)
Q5E1N7 0 763 78 1 467 3 atpD ATP synthase subunit beta Aliivibrio fischeri (strain ATCC 700601 / ES114)
B2FHY8 0 762 79 2 466 3 atpD ATP synthase subunit beta Stenotrophomonas maltophilia (strain K279a)
Q83AF5 0 762 81 1 458 3 atpD ATP synthase subunit beta Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9KBF7 0 762 81 1 458 3 atpD ATP synthase subunit beta Coxiella burnetii (strain Dugway 5J108-111)
Q8PGG7 0 762 79 3 466 3 atpD ATP synthase subunit beta Xanthomonas axonopodis pv. citri (strain 306)
Q82XP8 0 762 82 2 457 3 atpD ATP synthase subunit beta Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
A1U7H4 0 762 79 1 460 3 atpD ATP synthase subunit beta Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
A9NBD0 0 762 81 1 458 3 atpD ATP synthase subunit beta Coxiella burnetii (strain RSA 331 / Henzerling II)
Q87KA8 0 761 78 1 467 3 atpD ATP synthase subunit beta Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
P12986 0 761 78 1 467 1 atpD ATP synthase subunit beta Vibrio alginolyticus
A5EXL4 0 760 80 1 460 3 atpD ATP synthase subunit beta Dichelobacter nodosus (strain VCS1703A)
Q5H4Y4 0 759 79 3 466 3 atpD ATP synthase subunit beta Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SQB0 0 759 79 3 466 3 atpD ATP synthase subunit beta Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2P7Q4 0 759 79 3 466 3 atpD ATP synthase subunit beta Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q3BP15 0 759 78 2 466 3 atpD ATP synthase subunit beta Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
B0RWC2 0 758 79 2 466 3 atpD ATP synthase subunit beta Xanthomonas campestris pv. campestris (strain B100)
Q9JXQ2 0 758 79 2 466 3 atpD ATP synthase subunit beta Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
A0Q8D9 0 758 81 1 460 3 atpD ATP synthase subunit beta Francisella tularensis subsp. novicida (strain U112)
A1T0Y9 0 758 79 2 467 3 atpD2 ATP synthase subunit beta 2 Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
A1KW11 0 758 79 2 466 3 atpD ATP synthase subunit beta Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
A9M123 0 758 79 2 466 3 atpD ATP synthase subunit beta Neisseria meningitidis serogroup C (strain 053442)
A6T470 0 758 79 3 467 3 atpD ATP synthase subunit beta Janthinobacterium sp. (strain Marseille)
B2SEY1 0 758 80 1 460 3 atpD ATP synthase subunit beta Francisella tularensis subsp. mediasiatica (strain FSC147)
Q8PCZ5 0 757 79 2 466 3 atpD ATP synthase subunit beta Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UQF4 0 757 79 2 466 3 atpD ATP synthase subunit beta Xanthomonas campestris pv. campestris (strain 8004)
B4RJG0 0 757 79 2 466 3 atpD ATP synthase subunit beta Neisseria gonorrhoeae (strain NCCP11945)
Q5F4Z0 0 757 79 2 466 3 atpD ATP synthase subunit beta Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
A4IW24 0 756 80 1 460 3 atpD ATP synthase subunit beta Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NIK3 0 756 80 1 460 3 atpD ATP synthase subunit beta Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q14K06 0 756 80 1 460 3 atpD ATP synthase subunit beta Francisella tularensis subsp. tularensis (strain FSC 198)
Q9JW70 0 756 79 2 466 3 atpD ATP synthase subunit beta Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A4GAG9 0 755 79 3 467 3 atpD ATP synthase subunit beta Herminiimonas arsenicoxydans
B0TWS7 0 755 80 1 460 3 atpD ATP synthase subunit beta Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
Q89B39 0 754 77 1 465 3 atpD ATP synthase subunit beta Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q1GXN0 0 753 79 1 464 3 atpD ATP synthase subunit beta Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q6LKZ6 0 752 77 1 461 3 atpD2 ATP synthase subunit beta 2 Photobacterium profundum (strain SS9)
Q0BK84 0 751 80 1 460 3 atpD ATP synthase subunit beta Francisella tularensis subsp. holarctica (strain OSU18)
Q2A1I2 0 751 80 1 460 3 atpD ATP synthase subunit beta Francisella tularensis subsp. holarctica (strain LVS)
A7NEH4 0 751 80 1 460 3 atpD ATP synthase subunit beta Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Q7VQV6 0 750 77 1 462 3 atpD ATP synthase subunit beta Blochmanniella floridana
A9AJG4 0 749 80 2 460 3 atpD ATP synthase subunit beta Burkholderia multivorans (strain ATCC 17616 / 249)
A2S6J8 0 749 80 2 460 3 atpD ATP synthase subunit beta Burkholderia mallei (strain NCTC 10229)
B0VBP3 0 748 78 3 466 3 atpD ATP synthase subunit beta Acinetobacter baumannii (strain AYE)
A3M144 0 748 78 3 466 1 atpD ATP synthase subunit beta Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0VNK4 0 748 78 3 466 3 atpD ATP synthase subunit beta Acinetobacter baumannii (strain SDF)
B2I102 0 748 78 3 466 3 atpD ATP synthase subunit beta Acinetobacter baumannii (strain ACICU)
B7I1W4 0 748 78 3 466 3 atpD ATP synthase subunit beta Acinetobacter baumannii (strain AB0057)
B7H294 0 748 78 3 466 3 atpD ATP synthase subunit beta Acinetobacter baumannii (strain AB307-0294)
A4JA35 0 748 80 2 460 3 atpD ATP synthase subunit beta Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q2STE9 0 748 80 2 460 1 atpD1 ATP synthase subunit beta 1 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63PI0 0 748 80 2 460 3 atpD1 ATP synthase subunit beta 1 Burkholderia pseudomallei (strain K96243)
A3NF40 0 748 80 2 460 3 atpD1 ATP synthase subunit beta 1 Burkholderia pseudomallei (strain 668)
Q3JXV8 0 748 80 2 460 3 atpD1 ATP synthase subunit beta 1 Burkholderia pseudomallei (strain 1710b)
A3P0Z0 0 748 80 2 460 3 atpD1 ATP synthase subunit beta 1 Burkholderia pseudomallei (strain 1106a)
A1V8T1 0 748 80 2 460 3 atpD1 ATP synthase subunit beta 1 Burkholderia mallei (strain SAVP1)
Q62FR5 0 748 80 2 460 3 atpD1 ATP synthase subunit beta 1 Burkholderia mallei (strain ATCC 23344)
A3MQJ9 0 748 80 2 460 3 atpD1 ATP synthase subunit beta 1 Burkholderia mallei (strain NCTC 10247)
Q39KX6 0 748 80 2 460 3 atpD ATP synthase subunit beta Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q13SQ2 0 747 80 2 460 3 atpD2 ATP synthase subunit beta 2 Paraburkholderia xenovorans (strain LB400)
B1YQL4 0 746 80 2 460 3 atpD ATP synthase subunit beta Burkholderia ambifaria (strain MC40-6)
A1K1S2 0 746 78 1 465 3 atpD ATP synthase subunit beta Azoarcus sp. (strain BH72)
B4EEY9 0 746 80 2 460 3 atpD ATP synthase subunit beta Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A1TJ41 0 745 79 2 464 3 atpD ATP synthase subunit beta Paracidovorax citrulli (strain AAC00-1)
Q1BRB0 0 745 80 2 460 3 atpD ATP synthase subunit beta Burkholderia orbicola (strain AU 1054)
B1JSV7 0 745 80 2 460 3 atpD ATP synthase subunit beta Burkholderia orbicola (strain MC0-3)
A0K2Y3 0 745 80 2 460 3 atpD ATP synthase subunit beta Burkholderia cenocepacia (strain HI2424)
Q6FFK0 0 745 78 3 466 3 atpD ATP synthase subunit beta Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q1LHL0 0 745 78 1 466 3 atpD ATP synthase subunit beta Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q0BJL5 0 745 80 2 460 3 atpD ATP synthase subunit beta Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q3SF66 0 743 79 2 460 3 atpD ATP synthase subunit beta Thiobacillus denitrificans (strain ATCC 25259)
Q21DK8 0 743 78 2 461 3 atpD ATP synthase subunit beta Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q223D6 0 743 78 2 464 3 atpD1 ATP synthase subunit beta 1 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q46VY0 0 742 77 1 466 3 atpD ATP synthase subunit beta Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
P42468 0 742 80 3 460 3 atpD ATP synthase subunit beta Burkholderia cepacia
Q8XU76 0 742 78 1 466 3 atpD ATP synthase subunit beta Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q87E90 0 741 75 2 466 3 atpD ATP synthase subunit beta Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I877 0 741 75 2 466 3 atpD ATP synthase subunit beta Xylella fastidiosa (strain M23)
Q8D3J3 0 741 77 0 459 3 atpD ATP synthase subunit beta Wigglesworthia glossinidia brevipalpis
A2SC70 0 741 79 3 466 3 atpD ATP synthase subunit beta Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
Q477Z1 0 741 78 2 466 3 atpD ATP synthase subunit beta Dechloromonas aromatica (strain RCB)
Q7VU44 0 741 78 1 465 3 atpD ATP synthase subunit beta Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
B9MBA3 0 741 79 2 464 3 atpD ATP synthase subunit beta Acidovorax ebreus (strain TPSY)
B1XSD4 0 741 77 1 466 3 atpD ATP synthase subunit beta Polynucleobacter necessarius subsp. necessarius (strain STIR1)
B3R7L5 0 741 78 1 466 3 atpD ATP synthase subunit beta Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
A1W2T7 0 741 79 2 464 3 atpD ATP synthase subunit beta Acidovorax sp. (strain JS42)
Q9PE85 0 741 75 2 466 3 atpD ATP synthase subunit beta Xylella fastidiosa (strain 9a5c)
Q7W3B0 0 740 78 1 465 3 atpD ATP synthase subunit beta Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WEM9 0 740 78 1 465 3 atpD ATP synthase subunit beta Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q2KU36 0 740 78 1 465 3 atpD ATP synthase subunit beta Bordetella avium (strain 197N)
A7N6Q5 0 739 78 1 461 3 atpD2 ATP synthase subunit beta 2 Vibrio campbellii (strain ATCC BAA-1116)
A1WF58 0 739 79 2 464 3 atpD ATP synthase subunit beta Verminephrobacter eiseniae (strain EF01-2)
B0U598 0 738 75 2 466 3 atpD ATP synthase subunit beta Xylella fastidiosa (strain M12)
A4SUT4 0 738 77 1 466 3 atpD ATP synthase subunit beta Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
Q0K5M7 0 738 78 1 466 3 atpD ATP synthase subunit beta Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q5P4E2 0 738 78 1 465 3 atpD ATP synthase subunit beta Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q4FQ37 0 736 76 4 474 3 atpD ATP synthase subunit beta Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q1Q899 0 733 76 4 474 3 atpD ATP synthase subunit beta Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
A9HY42 0 733 77 1 465 3 atpD ATP synthase subunit beta Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
P41168 0 732 77 1 459 3 atpD ATP synthase subunit beta Acidithiobacillus ferridurans
A5WBW1 0 729 75 4 473 3 atpD ATP synthase subunit beta Psychrobacter sp. (strain PRwf-1)
A9BPU7 0 727 78 3 464 3 atpD ATP synthase subunit beta Delftia acidovorans (strain DSM 14801 / SPH-1)
Q12GQ0 0 726 78 3 466 3 atpD ATP synthase subunit beta Polaromonas sp. (strain JS666 / ATCC BAA-500)
A1VIV2 0 725 78 3 464 3 atpD1 ATP synthase subunit beta 1 Polaromonas naphthalenivorans (strain CJ2)
Q31DM0 0 716 76 1 457 3 atpD ATP synthase subunit beta Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q2RFX9 0 678 71 1 461 1 atpD ATP synthase subunit beta Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
B0THN2 0 673 69 2 470 3 atpD ATP synthase subunit beta Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
Q4FP38 0 668 71 3 467 3 atpD ATP synthase subunit beta Pelagibacter ubique (strain HTCC1062)
Q8UC76 0 668 70 2 464 3 atpD ATP synthase subunit beta Agrobacterium fabrum (strain C58 / ATCC 33970)
B9MS68 0 665 70 1 457 3 atpD ATP synthase subunit beta Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
Q03235 0 664 69 4 467 3 atpD ATP synthase subunit beta Pectinatus frisingensis
A4XKX0 0 663 70 1 457 3 atpD ATP synthase subunit beta Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
A8GY40 0 663 69 3 467 3 atpD ATP synthase subunit beta Rickettsia bellii (strain OSU 85-389)
A1ALL7 0 663 71 2 464 3 atpD1 ATP synthase subunit beta 1 Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
A1AP52 0 662 70 2 464 3 atpD2 ATP synthase subunit beta 2 Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
Q1RKD7 0 661 69 3 467 3 atpD ATP synthase subunit beta Rickettsia bellii (strain RML369-C)
B3EA01 0 661 71 2 463 3 atpD ATP synthase subunit beta Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
A7IH31 0 659 69 2 469 3 atpD ATP synthase subunit beta Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
A8MJV9 0 659 70 1 456 3 atpD ATP synthase subunit beta Alkaliphilus oremlandii (strain OhILAs)
Q5LNP1 0 657 69 3 467 3 atpD ATP synthase subunit beta Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
A6UDM1 0 656 69 1 460 3 atpD ATP synthase subunit beta Sinorhizobium medicae (strain WSM419)
Q4UK18 0 656 69 3 465 3 atpD ATP synthase subunit beta Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q21CY7 0 656 69 2 465 3 atpD ATP synthase subunit beta Rhodopseudomonas palustris (strain BisB18)
Q2J3I4 0 656 69 2 465 3 atpD ATP synthase subunit beta Rhodopseudomonas palustris (strain HaA2)
P10719 0 656 70 3 466 1 Atp5f1b ATP synthase subunit beta, mitochondrial Rattus norvegicus
B9LZ84 0 655 69 2 463 3 atpD ATP synthase subunit beta Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
Q5HX59 0 655 70 3 462 3 atpD ATP synthase subunit beta Campylobacter jejuni (strain RM1221)
A1VXJ0 0 655 70 3 462 3 atpD ATP synthase subunit beta Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q0PC30 0 655 70 3 462 3 atpD ATP synthase subunit beta Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A8FJR2 0 655 70 3 462 3 atpD ATP synthase subunit beta Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
A4YKE0 0 655 69 2 468 3 atpD ATP synthase subunit beta Bradyrhizobium sp. (strain ORS 278)
B9KES3 0 655 70 4 462 3 atpD ATP synthase subunit beta Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
Q89X74 0 655 68 2 469 3 atpD ATP synthase subunit beta Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
C3M9S1 0 654 69 1 460 3 atpD ATP synthase subunit beta Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q162S9 0 654 70 3 467 3 atpD ATP synthase subunit beta Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q74GY0 0 654 70 3 463 3 atpD ATP synthase subunit beta Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
P42465 0 654 69 2 462 3 atpD ATP synthase subunit beta Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
P06576 0 654 70 3 466 1 ATP5F1B ATP synthase subunit beta, mitochondrial Homo sapiens
A8HS10 0 654 69 2 470 3 atpD ATP synthase subunit beta Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q92LK8 0 654 69 1 460 3 atpD ATP synthase subunit beta Rhizobium meliloti (strain 1021)
Q1QQS8 0 653 68 2 465 3 atpD ATP synthase subunit beta Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
A7ZC37 0 653 70 3 462 3 atpD ATP synthase subunit beta Campylobacter concisus (strain 13826)
P56480 0 653 70 3 466 1 Atp5f1b ATP synthase subunit beta, mitochondrial Mus musculus
P00829 0 653 70 3 465 1 ATP5F1B ATP synthase subunit beta, mitochondrial Bos taurus
Q68VU8 0 652 69 3 465 3 atpD ATP synthase subunit beta Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q6NDD2 0 652 69 2 465 3 atpD ATP synthase subunit beta Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
C6E9F1 0 652 70 2 463 3 atpD ATP synthase subunit beta Geobacter sp. (strain M21)
Q13DP2 0 652 69 2 465 3 atpD ATP synthase subunit beta Rhodopseudomonas palustris (strain BisB5)
Q11DD5 0 652 69 2 464 3 atpD ATP synthase subunit beta Chelativorans sp. (strain BNC1)
A6TK65 0 652 69 2 463 3 atpD ATP synthase subunit beta Alkaliphilus metalliredigens (strain QYMF)
Q8KAC9 0 652 69 2 462 3 atpD2 ATP synthase subunit beta 2 Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
A5E950 0 652 68 2 468 3 atpD1 ATP synthase subunit beta 1 Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
A8F2U0 0 652 68 3 467 3 atpD ATP synthase subunit beta Rickettsia massiliae (strain Mtu5)
B5EFI7 0 652 70 2 463 3 atpD ATP synthase subunit beta Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
B6JD09 0 652 69 2 464 3 atpD ATP synthase subunit beta Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
Q3B6W8 0 652 68 2 462 3 atpD1 ATP synthase subunit beta 1 Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
Q07UZ5 0 651 68 2 465 3 atpD ATP synthase subunit beta Rhodopseudomonas palustris (strain BisA53)
Q9PTY0 0 651 70 3 465 2 ATP5F1B ATP synthase subunit beta, mitochondrial Cyprinus carpio
A7H1I1 0 651 69 3 462 3 atpD ATP synthase subunit beta Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
Q98EV8 0 650 70 2 464 3 atpD ATP synthase subunit beta Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q2JX57 0 650 69 2 463 3 atpD ATP synthase subunit beta Synechococcus sp. (strain JA-3-3Ab)
Q92G88 0 650 68 3 467 3 atpD ATP synthase subunit beta Rickettsia conorii (strain ATCC VR-613 / Malish 7)
A6Q4C0 0 650 69 3 462 3 atpD ATP synthase subunit beta Nitratiruptor sp. (strain SB155-2)
Q5ZLC5 0 650 70 3 465 1 ATP5F1B ATP synthase subunit beta, mitochondrial Gallus gallus
A4WUM7 0 650 69 4 471 3 atpD ATP synthase subunit beta Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
B4SAN6 0 650 68 2 462 3 atpD ATP synthase subunit beta Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
Q39Q56 0 650 69 3 463 3 atpD ATP synthase subunit beta Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
C3PLT1 0 649 68 3 467 3 atpD ATP synthase subunit beta Rickettsia africae (strain ESF-5)
B3EDQ7 0 649 68 2 462 3 atpD ATP synthase subunit beta Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
C4K227 0 649 68 3 467 3 atpD ATP synthase subunit beta Rickettsia peacockii (strain Rustic)
Q3SVJ1 0 649 68 2 464 3 atpD ATP synthase subunit beta Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
A4SC45 0 649 67 2 462 3 atpD ATP synthase subunit beta Chlorobium phaeovibrioides (strain DSM 265 / 1930)
A7H017 0 649 69 3 462 3 atpD ATP synthase subunit beta Campylobacter curvus (strain 525.92)
A8GPZ4 0 648 68 3 465 3 atpD ATP synthase subunit beta Rickettsia akari (strain Hartford)
Q180W5 0 648 69 2 457 3 atpD ATP synthase subunit beta Clostridioides difficile (strain 630)
O50290 0 648 69 3 465 3 atpD ATP synthase subunit beta Rickettsia prowazekii (strain Madrid E)
A7HT52 0 648 68 2 471 3 atpD ATP synthase subunit beta Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
A5G9D8 0 648 68 2 463 3 atpD ATP synthase subunit beta Geotalea uraniireducens (strain Rf4)
A1BCJ2 0 648 68 2 462 3 atpD ATP synthase subunit beta Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
A0Q2Z4 0 647 68 0 457 3 atpD ATP synthase subunit beta Clostridium novyi (strain NT)
Q67TB7 0 647 69 2 463 3 atpD ATP synthase subunit beta Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q05825 0 647 69 3 465 1 ATPsynbeta ATP synthase subunit beta, mitochondrial Drosophila melanogaster
A9IYW6 0 646 69 2 469 3 atpD ATP synthase subunit beta Bartonella tribocorum (strain CIP 105476 / IBS 506)
Q3J431 0 646 69 4 471 3 atpD1 ATP synthase subunit beta 1 Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A3PIB9 0 646 69 4 471 3 atpD1 ATP synthase subunit beta 1 Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
Q05FY1 0 646 67 2 448 3 atpD ATP synthase subunit beta Carsonella ruddii (strain PV)
Q8FYR5 0 646 71 1 452 3 atpD ATP synthase subunit beta Brucella suis biovar 1 (strain 1330)
A9WWS2 0 646 71 1 452 3 atpD ATP synthase subunit beta Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VSE1 0 646 71 1 452 3 atpD ATP synthase subunit beta Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q8YJ35 0 646 71 1 452 3 atpD ATP synthase subunit beta Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
A9M837 0 646 71 1 452 3 atpD ATP synthase subunit beta Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
A8LJR4 0 646 69 3 467 3 atpD2 ATP synthase subunit beta 2 Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
P05038 0 645 70 3 458 1 atpD ATP synthase subunit beta Rhodospirillum rubrum
Q2RV18 0 645 70 3 458 3 atpD ATP synthase subunit beta Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q1CX36 0 645 67 3 470 3 atpD ATP synthase subunit beta Myxococcus xanthus (strain DK1622)
Q24MP1 0 645 67 2 463 3 atpD ATP synthase subunit beta Desulfitobacterium hafniense (strain Y51)
B1I6J7 0 645 69 2 468 3 atpD ATP synthase subunit beta Desulforudis audaxviator (strain MP104C)
B0T335 0 645 68 4 472 3 atpD ATP synthase subunit beta Caulobacter sp. (strain K31)
Q6FYM3 0 645 69 2 471 3 atpD ATP synthase subunit beta Bartonella quintana (strain Toulouse)
A8GTS6 0 645 67 3 467 3 atpD ATP synthase subunit beta Rickettsia rickettsii (strain Sheila Smith)
B0BVB6 0 645 67 3 467 3 atpD ATP synthase subunit beta Rickettsia rickettsii (strain Iowa)
A8F004 0 645 68 3 467 3 atpD ATP synthase subunit beta Rickettsia canadensis (strain McKiel)
Q1MAZ2 0 645 69 2 466 3 atpD ATP synthase subunit beta Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
P46561 0 645 68 3 466 1 atp-2 ATP synthase subunit beta, mitochondrial Caenorhabditis elegans
Q57B88 0 645 70 1 452 3 atpD ATP synthase subunit beta Brucella abortus biovar 1 (strain 9-941)
Q2YLE6 0 645 70 1 452 3 atpD ATP synthase subunit beta Brucella abortus (strain 2308)
Q2JIV9 0 644 69 2 463 3 atpD ATP synthase subunit beta Synechococcus sp. (strain JA-2-3B'a(2-13))
A1UR49 0 644 69 2 471 3 atpD ATP synthase subunit beta Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
B8FZ34 0 644 67 2 463 3 atpD ATP synthase subunit beta Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
P35110 0 644 68 2 462 3 atpD ATP synthase subunit beta Chlorobium limicola
A6WXX1 0 644 69 1 460 3 atpD ATP synthase subunit beta Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
A8EV70 0 644 69 4 462 3 atpD ATP synthase subunit beta Aliarcobacter butzleri (strain RM4018)
A0RR26 0 643 69 3 462 3 atpD ATP synthase subunit beta Campylobacter fetus subsp. fetus (strain 82-40)
Q3AP13 0 643 67 2 462 3 atpD ATP synthase subunit beta Chlorobium chlorochromatii (strain CaD3)
Q3Z8Z2 0 642 67 1 461 3 atpD ATP synthase subunit beta Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195)
B5ZSN7 0 642 69 2 466 3 atpD ATP synthase subunit beta Rhizobium leguminosarum bv. trifolii (strain WSM2304)
A7I177 0 642 69 3 462 3 atpD ATP synthase subunit beta Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
Q6G1W9 0 642 68 2 471 3 atpD ATP synthase subunit beta Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
A1VFJ5 0 642 69 2 461 3 atpD ATP synthase subunit beta Nitratidesulfovibrio vulgaris (strain DP4)
Q72E04 0 642 69 2 461 3 atpD ATP synthase subunit beta Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q3A946 0 641 70 2 453 3 atpD ATP synthase subunit beta Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
P38482 0 640 68 3 466 1 ATP2 ATP synthase subunit beta, mitochondrial Chlamydomonas reinhardtii
Q2G5N5 0 639 68 3 472 3 atpD ATP synthase subunit beta Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
Q0C100 0 639 69 3 455 3 atpD ATP synthase subunit beta Hyphomonas neptunium (strain ATCC 15444)
Q7NHG7 0 639 68 3 464 3 atpD ATP synthase subunit beta Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q9A2V9 0 639 68 4 468 3 atpD ATP synthase subunit beta Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
A7HIX7 0 639 67 3 471 3 atpD ATP synthase subunit beta Anaeromyxobacter sp. (strain Fw109-5)
A9H9A8 0 639 68 3 467 3 atpD ATP synthase subunit beta Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
B2UZK0 0 639 66 0 457 3 atpD ATP synthase subunit beta Clostridium botulinum (strain Alaska E43 / Type E3)
Q3A605 0 639 68 3 466 3 atpD1 ATP synthase subunit beta 1 Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
A3DIM9 0 638 67 2 464 3 atpD ATP synthase subunit beta Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q39ZU1 0 638 68 3 466 3 atpD3 ATP synthase subunit beta 3 Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q8RGE2 0 637 68 2 461 1 atpD ATP synthase subunit beta Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q5FRC5 0 637 68 3 468 3 atpD1 ATP synthase subunit beta 1 Gluconobacter oxydans (strain 621H)
B3PQ68 0 637 69 2 466 3 atpD ATP synthase subunit beta Rhizobium etli (strain CIAT 652)
B2TK00 0 637 66 0 457 3 atpD ATP synthase subunit beta Clostridium botulinum (strain Eklund 17B / Type B)
Q2K3H0 0 637 69 2 466 3 atpD ATP synthase subunit beta Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
P42469 0 635 66 3 470 3 atpD ATP synthase subunit beta Stigmatella aurantiaca
Q8F2J5 0 635 67 2 463 3 atpD ATP synthase subunit beta Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72SX9 0 635 67 2 463 3 atpD ATP synthase subunit beta Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
P05440 0 635 68 3 460 3 atpD ATP synthase subunit beta Fuscovulum blasticum
Q3ZZT7 0 635 67 1 461 3 atpD ATP synthase subunit beta Dehalococcoides mccartyi (strain CBDB1)
A5FRQ5 0 635 67 1 461 3 atpD ATP synthase subunit beta Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1)
A5N3H7 0 635 67 0 457 3 atpD ATP synthase subunit beta Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
P29707 0 635 69 3 459 1 atpD ATP synthase subunit beta, sodium ion specific Propionigenium modestum
B8DRD2 0 635 68 2 461 3 atpD ATP synthase subunit beta Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
B8J439 0 635 67 2 461 3 atpD ATP synthase subunit beta Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
B5YI24 0 635 67 2 468 3 atpD ATP synthase subunit beta Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
A6QB59 0 635 68 4 463 3 atpD ATP synthase subunit beta Sulfurovum sp. (strain NBC37-1)
Q1GEU8 0 634 68 3 467 3 atpD ATP synthase subunit beta Ruegeria sp. (strain TM1040)
P72247 0 634 68 3 461 1 atpD ATP synthase subunit beta Rhodobacter capsulatus
A5CYE2 0 634 69 2 454 3 atpD ATP synthase subunit beta Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
A5FZ54 0 634 67 3 468 3 atpD ATP synthase subunit beta Acidiphilium cryptum (strain JF-5)
Q04ZU5 0 634 67 3 463 3 atpD ATP synthase subunit beta Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04S18 0 634 67 3 463 3 atpD ATP synthase subunit beta Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
Q28TJ6 0 634 68 3 467 3 atpD ATP synthase subunit beta Jannaschia sp. (strain CCS1)
B3QUP6 0 633 67 3 463 3 atpD ATP synthase subunit beta Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
Q8RC15 0 633 67 2 461 3 atpD ATP synthase subunit beta Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q25117 0 632 67 3 465 2 None ATP synthase subunit beta, mitochondrial Hemicentrotus pulcherrimus
A1B8P0 0 632 68 3 467 1 atpD ATP synthase subunit beta Paracoccus denitrificans (strain Pd 1222)
B9L7Y7 0 632 68 4 463 3 atpD ATP synthase subunit beta Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH)
B0SLC8 0 632 66 4 466 3 atpD ATP synthase subunit beta Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris)
B0SDA5 0 632 66 4 466 3 atpD ATP synthase subunit beta Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames)
A9KK92 0 632 68 2 457 3 atpD ATP synthase subunit beta Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
B3EJK9 0 632 67 2 462 3 atpD ATP synthase subunit beta Chlorobium phaeobacteroides (strain BS1)
Q313W0 0 631 68 2 461 3 atpD ATP synthase subunit beta Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
C0Z776 0 631 67 4 469 3 atpD ATP synthase subunit beta Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
P50002 0 631 68 2 459 1 atpD ATP synthase subunit beta, sodium ion specific Acetobacterium woodii (strain ATCC 29683 / DSM 1030 / JCM 2381 / KCTC 1655 / WB1)
B6JMX2 0 630 67 4 462 3 atpD ATP synthase subunit beta Helicobacter pylori (strain P12)
Q2N8Z2 0 630 67 3 471 3 atpD ATP synthase subunit beta Erythrobacter litoralis (strain HTCC2594)
Q6MGM7 0 630 67 2 466 3 atpD ATP synthase subunit beta Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
B7GMF3 0 630 67 4 469 3 atpD ATP synthase subunit beta Anoxybacillus flavithermus (strain DSM 21510 / WK1)
P55988 0 630 67 4 462 3 atpD ATP synthase subunit beta Helicobacter pylori (strain ATCC 700392 / 26695)
A9BFX3 0 630 66 2 460 3 atpD ATP synthase subunit beta Petrotoga mobilis (strain DSM 10674 / SJ95)
Q1CSD5 0 630 66 4 462 3 atpD ATP synthase subunit beta Helicobacter pylori (strain HPAG1)
P42470 0 629 67 3 462 3 atpD ATP synthase subunit beta Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q30QQ1 0 629 68 4 462 3 atpD ATP synthase subunit beta Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
Q9ZK81 0 629 66 4 462 3 atpD ATP synthase subunit beta Helicobacter pylori (strain J99 / ATCC 700824)
Q17Y78 0 629 67 4 462 3 atpD ATP synthase subunit beta Helicobacter acinonychis (strain Sheeba)
C5D990 0 629 66 3 469 3 atpD ATP synthase subunit beta Geobacillus sp. (strain WCH70)
Q9C5A9 0 629 66 3 469 1 At5g08680 ATP synthase subunit beta-3, mitochondrial Arabidopsis thaliana
B5Z8D0 0 629 66 4 462 3 atpD ATP synthase subunit beta Helicobacter pylori (strain G27)
P83484 0 629 66 3 469 1 At5g08690 ATP synthase subunit beta-2, mitochondrial Arabidopsis thaliana
P19023 0 629 66 3 468 2 ATPB ATP synthase subunit beta, mitochondrial Zea mays
P83483 0 629 66 3 469 1 At5g08670 ATP synthase subunit beta-1, mitochondrial Arabidopsis thaliana
Q01859 0 628 66 3 468 1 ATPB ATP synthase subunit beta, mitochondrial Oryza sativa subsp. japonica
Q2LR05 0 628 67 2 465 3 atpD ATP synthase subunit beta Syntrophus aciditrophicus (strain SB)
Q1MRB8 0 627 68 2 461 3 atpD ATP synthase subunit beta Lawsonia intracellularis (strain PHE/MN1-00)
Q98QU5 0 627 68 1 456 3 atpD1 ATP synthase subunit beta 1 Mycoplasmopsis pulmonis (strain UAB CTIP)
P06540 0 627 65 3 470 3 atpD ATP synthase subunit beta Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q5KUJ3 0 626 66 3 469 1 atpD ATP synthase subunit beta Geobacillus kaustophilus (strain HTA426)
A6LQH6 0 626 66 0 457 3 atpD ATP synthase subunit beta Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
Q9Z687 0 626 66 1 458 3 atpD ATP synthase subunit beta Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
A6LJR1 0 626 69 2 462 3 atpD ATP synthase subunit beta Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429)
Q2VZN2 0 625 68 3 458 3 atpD ATP synthase subunit beta Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
P47639 0 625 66 2 462 3 atpD ATP synthase subunit beta Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q0BQE8 0 625 67 3 459 3 atpD ATP synthase subunit beta Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
P22068 0 625 67 4 465 1 atp2 ATP synthase subunit beta, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)
A9AVV4 0 624 66 2 463 3 atpD ATP synthase subunit beta Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785 / 114-95)
Q7VJ21 0 624 67 4 462 3 atpD ATP synthase subunit beta Helicobacter hepaticus (strain ATCC 51449 / 3B1)
A4ITI9 0 624 66 3 469 3 atpD ATP synthase subunit beta Geobacillus thermodenitrificans (strain NG80-2)
A7GV56 0 624 67 2 462 3 atpD ATP synthase subunit beta Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q3MAS0 0 624 65 3 470 3 atpD ATP synthase subunit beta Trichormus variabilis (strain ATCC 29413 / PCC 7937)
B2IUL2 0 624 65 3 470 3 atpD ATP synthase subunit beta Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
P42466 0 624 65 2 463 3 atpD ATP synthase subunit beta Herpetosiphon aurantiacus
P00830 0 624 68 2 458 1 ATP2 ATP synthase subunit beta, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
O50341 0 624 68 2 462 3 atpD ATP synthase subunit beta Fervidobacterium islandicum
A4J999 0 623 68 2 468 3 atpD ATP synthase subunit beta Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
Q6MAK7 0 623 64 2 463 3 atpD ATP synthase subunit beta Protochlamydia amoebophila (strain UWE25)
Q9LA80 0 623 66 3 469 3 atpD ATP synthase subunit beta Geobacillus thermoleovorans
P41009 0 623 66 3 469 3 atpD ATP synthase subunit beta Bacillus caldotenax
Q50331 0 622 66 2 459 3 atpD ATP synthase subunit beta Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q2ST34 0 622 67 2 457 3 atpD ATP synthase subunit beta Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
Q6CFT7 0 621 68 3 467 1 ATP2 ATP synthase subunit beta, mitochondrial Yarrowia lipolytica (strain CLIB 122 / E 150)
B7IG44 0 621 69 3 463 3 atpD ATP synthase subunit beta Thermosipho africanus (strain TCF52B)
Q1GQS5 0 621 66 3 466 3 atpD ATP synthase subunit beta Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
A7HJV7 0 621 68 2 462 3 atpD ATP synthase subunit beta Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1)
Q6AQ10 0 620 67 2 459 3 atpD ATP synthase subunit beta Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q0P3P2 0 620 65 6 474 3 atpB ATP synthase subunit beta, chloroplastic Ostreococcus tauri
Q0SQZ5 0 620 65 1 458 3 atpD ATP synthase subunit beta Clostridium perfringens (strain SM101 / Type A)
B8FGT4 0 620 66 2 463 3 atpD ATP synthase subunit beta Desulfatibacillum aliphaticivorans
A8F3K2 0 619 68 2 460 3 atpD ATP synthase subunit beta Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO)
C0HK52 0 619 68 3 460 1 ATP2 ATP synthase subunit beta, mitochondrial Pichia angusta
P07677 0 619 66 3 469 1 atpD ATP synthase subunit beta Bacillus sp. (strain PS3)
P17614 0 619 65 3 466 1 ATPB ATP synthase subunit beta, mitochondrial Nicotiana plumbaginifolia
P23704 0 619 67 2 463 2 atp-2 ATP synthase subunit beta, mitochondrial Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
P49376 0 619 67 2 459 3 ATP2 ATP synthase subunit beta, mitochondrial Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
Q8XID4 0 618 65 1 458 3 atpD ATP synthase subunit beta Clostridium perfringens (strain 13 / Type A)
Q0TNC4 0 618 65 1 458 3 atpD ATP synthase subunit beta Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
B1KSS8 0 618 66 0 457 3 atpD ATP synthase subunit beta Clostridium botulinum (strain Loch Maree / Type A3)
Q2GKK8 0 618 67 5 469 3 atpD ATP synthase subunit beta Anaplasma phagocytophilum (strain HZ)
A7G9Q9 0 618 66 0 457 3 atpD ATP synthase subunit beta Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
B1IE34 0 618 66 0 457 3 atpD ATP synthase subunit beta Clostridium botulinum (strain Okra / Type B1)
B3CN17 0 617 65 6 472 3 atpD ATP synthase subunit beta Wolbachia pipientis subsp. Culex pipiens (strain wPip)
B1LBB9 0 617 67 2 462 3 atpD ATP synthase subunit beta Thermotoga sp. (strain RQ2)
A5ILX2 0 617 67 2 462 3 atpD ATP synthase subunit beta Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
B9K7U1 0 617 68 2 462 3 atpD ATP synthase subunit beta Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E)
O50550 0 617 67 2 462 3 atpD ATP synthase subunit beta Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
B8I579 0 617 65 1 460 3 atpD ATP synthase subunit beta Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
A5V3X5 0 617 66 3 464 3 atpD ATP synthase subunit beta Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS17650
Feature type CDS
Gene atpD
Product F0F1 ATP synthase subunit beta
Location 171887 - 173269 (strand: -1)
Length 1383 (nucleotides) / 460 (amino acids)

Contig

Accession term accessions NZ_VXKB01000007 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 196482 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2072
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00006 ATP synthase alpha/beta family, nucleotide-binding domain
PF02874 ATP synthase alpha/beta family, beta-barrel domain
PF22919 C-terminal domain of V and A type ATP synthase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0055 Energy production and conversion (C) C FoF1-type ATP synthase, beta subunit

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02112 F-type H+/Na+-transporting ATPase subunit beta [EC:7.1.2.2 7.2.2.1] Oxidative phosphorylation
Photosynthesis
Metabolic pathways		 F-type ATPase, prokaryotes and chloroplasts

Protein Sequence

MATGKIIQVIGAVVDAEFPQDAVPKVYDALEVMNGKEKLVLEVQQQLGGGVVRCIAMGTSDGLSRNLVVTDLGHPIEVPVGVKTLGRIMNVLGEPIDMKGEIGAEENWSIHRAAPTYEELSSSQELLETGIKVMDLICPFAKGGKVGLFGGAGVGKTVNMMELIRNIAIEHSGYSVFAGVGERTREGNDFYHEMTDSNVLDKVSLVYGQMNEPPGNRLRVALTGLTMAEKFRDEGRDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGILQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSRQIASLGIYPAVDPLDSTSRQLDPLVVGQEHYDVARGVQSILQRYQELKDIIAILGMDELSEEDKLVVARARKIQRFLSQPFFVAEVFTGSPGKFVSLKDTIRGFKGILEGDYDHLPEQAFYMVGTIEEAVEKAKKI

Flanking regions ( +/- flanking 50bp)

TGCTGCCGCGGTTTAACAGCTAGGTTTACGAATTACGCAGAGGATTCAAGATGGCTACTGGAAAAATCATCCAGGTTATCGGCGCCGTTGTGGACGCCGAATTTCCTCAGGATGCGGTACCGAAAGTGTACGACGCGCTTGAGGTTATGAATGGTAAAGAAAAGCTGGTGCTGGAAGTTCAGCAGCAGTTAGGCGGTGGTGTTGTCCGTTGTATCGCAATGGGTACATCTGACGGCCTGAGCCGTAACCTGGTCGTAACCGATTTAGGTCACCCGATTGAAGTACCGGTTGGTGTGAAAACCTTAGGACGTATCATGAACGTTCTGGGTGAACCTATCGATATGAAAGGTGAAATCGGCGCAGAAGAAAACTGGTCTATTCACCGTGCGGCACCTACTTATGAAGAACTGTCCAGCTCCCAGGAGTTGTTAGAGACAGGGATCAAAGTAATGGATCTGATTTGCCCGTTTGCAAAAGGCGGTAAAGTCGGTCTGTTCGGTGGTGCGGGTGTGGGTAAAACCGTAAACATGATGGAGCTTATCCGTAACATCGCGATTGAGCACTCCGGTTACTCTGTATTTGCAGGGGTCGGTGAGCGTACTCGTGAGGGTAACGACTTCTATCATGAAATGACCGATTCAAACGTTCTGGACAAAGTATCACTTGTGTACGGCCAGATGAACGAGCCACCGGGAAACCGTCTGCGCGTAGCACTGACCGGTCTGACCATGGCGGAAAAATTCCGTGATGAAGGCCGCGACGTACTGCTGTTCGTTGATAACATCTACCGTTATACACTGGCCGGTACAGAGGTATCTGCACTGTTAGGCCGTATGCCTTCAGCGGTAGGTTACCAGCCGACTCTGGCGGAAGAAATGGGTATTCTTCAGGAACGTATCACATCGACCAAAACAGGCTCTATCACGTCTGTACAGGCCGTTTACGTCCCTGCGGATGACTTAACTGACCCATCTCCTGCAACCACGTTCGCCCACCTGGATGCGACCGTTGTTCTGAGTCGTCAGATTGCGTCACTGGGTATCTACCCTGCGGTAGATCCTCTGGATTCCACCAGCCGTCAGCTTGACCCGCTTGTTGTTGGTCAGGAGCACTATGATGTGGCTCGTGGCGTGCAGTCAATTCTCCAGCGTTATCAGGAACTGAAAGATATCATCGCAATCCTCGGGATGGATGAGCTGTCAGAAGAAGATAAACTGGTTGTTGCCCGCGCCCGTAAAATCCAGCGCTTCCTTTCTCAGCCGTTCTTCGTGGCAGAAGTCTTCACTGGTTCACCAGGTAAGTTCGTTTCCCTTAAAGACACCATCCGTGGCTTTAAAGGTATTCTGGAAGGTGATTACGATCATCTGCCGGAACAAGCGTTCTACATGGTGGGTACCATTGAAGAAGCCGTGGAAAAAGCGAAGAAGATTTAATCCGGTTGACAGGAGGCTGATATGTCTGCAATGACGTTTCACCTGACGGT