Homologs in group_2947

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_15515 FBDBKF_15515 84.6 Morganella morganii S1 tar Methyl-accepting chemotaxis protein (MCP)
EHELCC_15875 EHELCC_15875 84.6 Morganella morganii S2 tar Methyl-accepting chemotaxis protein (MCP)
NLDBIP_16495 NLDBIP_16495 84.6 Morganella morganii S4 tar Methyl-accepting chemotaxis protein (MCP)
LHKJJB_16310 LHKJJB_16310 84.6 Morganella morganii S3 tar Methyl-accepting chemotaxis protein (MCP)
HKOGLL_16080 HKOGLL_16080 84.6 Morganella morganii S5 tar Methyl-accepting chemotaxis protein (MCP)

Distribution of the homologs in the orthogroup group_2947

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2947

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P07018 2.93e-59 201 40 0 297 1 tap Methyl-accepting chemotaxis protein IV Escherichia coli (strain K12)
P07017 5.46e-59 201 41 1 312 1 tar Methyl-accepting chemotaxis protein II Escherichia coli (strain K12)
P21823 6.23e-59 201 39 1 306 3 tas Methyl-accepting chemotaxis aspartate transducer Klebsiella aerogenes (strain ATCC 13048 / DSM 30053 / CCUG 1429 / JCM 1235 / KCTC 2190 / NBRC 13534 / NCIMB 10102 / NCTC 10006 / CDC 819-56)
P02941 2.62e-57 197 43 0 265 1 tar Methyl-accepting chemotaxis protein II Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q02755 2.12e-55 191 38 1 304 3 tcp Methyl-accepting chemotaxis citrate transducer Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P05704 6.3e-55 190 37 1 309 1 trg Methyl-accepting chemotaxis protein III Escherichia coli (strain K12)
P02942 8.49e-55 190 41 0 265 1 tsr Methyl-accepting chemotaxis protein I Escherichia coli (strain K12)
P21822 1.62e-53 187 41 0 265 3 tse Methyl-accepting chemotaxis serine transducer Klebsiella aerogenes (strain ATCC 13048 / DSM 30053 / CCUG 1429 / JCM 1235 / KCTC 2190 / NBRC 13534 / NCIMB 10102 / NCTC 10006 / CDC 819-56)
Q9I6V6 5.5e-53 187 43 0 251 1 mcpB Methyl-accepting chemotaxis protein McpB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q00986 3.96e-42 157 34 4 318 3 mcpA Chemoreceptor McpA Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
P50466 8.7e-38 144 37 0 267 1 aer Aerotaxis receptor Escherichia coli (strain K12)
Q02929 3.1e-34 134 40 0 205 3 Cthe_0039 Putative sensory transducer protein Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
P55439 5.51e-33 132 34 5 301 3 NGR_a03800 Probable chemoreceptor y4fA Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q9X0M7 2.69e-28 117 34 3 217 1 mcp2 Methyl-accepting chemotaxis protein 2 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
P55652 2.36e-27 115 34 0 188 3 NGR_a01640 Probable chemoreceptor y4sI Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q52877 2.06e-26 112 32 5 290 3 mcpE Probable chemoreceptor McpE Rhizobium meliloti (strain 1021)
P39217 6.54e-25 108 27 6 353 3 tlpB Methyl-accepting chemotaxis protein TlpB Bacillus subtilis (strain 168)
Q88N45 4.48e-23 103 26 3 298 1 mcpG Methyl-accepting chemotaxis protein McpG Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q88KP1 6.4e-23 102 28 3 311 1 mcpA Methyl-accepting chemotaxis protein McpA Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
P39214 6.47e-23 102 28 5 332 1 mcpA Methyl-accepting chemotaxis protein McpA Bacillus subtilis (strain 168)
Q882Z2 1.73e-22 101 28 6 315 3 pscA Methyl-accepting chemotaxis protein PscA Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
P39216 8.87e-22 99 27 7 360 3 tlpA Methyl-accepting chemotaxis protein TlpA Bacillus subtilis (strain 168)
P43500 3.84e-21 96 28 5 295 1 frzCD Frizzy aggregation protein FrzCD Myxococcus xanthus
Q9X1E2 8.48e-21 96 27 7 360 1 mcp4 Methyl-accepting chemotaxis protein 4 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
C0SP89 8.96e-21 96 26 5 325 2 yoaH Putative methyl-accepting chemotaxis protein YoaH Bacillus subtilis (strain 168)
P15492 2.52e-20 94 27 5 314 3 hlyB Methyl-accepting chemotaxis protein HlyB Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P54576 4.11e-20 94 29 9 333 1 mcpC Methyl-accepting chemotaxis protein McpC Bacillus subtilis (strain 168)
Q6HNQ4 4.36e-20 94 30 2 238 3 BT9727_0469 Probable methyl-accepting chemotaxis protein BT9727_0469 Bacillus thuringiensis subsp. konkukian (strain 97-27)
P39215 4.89e-20 94 32 3 229 1 mcpB Methyl-accepting chemotaxis protein McpB Bacillus subtilis (strain 168)
Q9I055 7.07e-20 93 28 9 308 1 mcpN Methyl-accepting chemotaxis protein McpN Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9I0I4 9.34e-20 93 28 5 252 1 tlpQ Methyl-accepting chemotaxis protein TlpQ Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9I0I6 1.24e-19 92 29 9 306 1 ctpM Methyl-accepting chemotaxis protein CtpM Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
G3XD24 1.87e-19 92 27 3 311 1 pctA Methyl-accepting chemotaxis protein PctA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q55445 2.33e-19 92 26 5 319 3 sll0041 Putative methyl-accepting chemotaxis protein sll0041 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q9HW91 3.76e-19 91 33 1 202 1 pctB Methyl-accepting chemotaxis protein PctB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9HW93 4.67e-19 91 33 1 202 1 pctC Methyl-accepting chemotaxis protein PctC Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q88D09 6.09e-19 90 29 4 240 1 mcpQ Methyl-accepting chemotaxis protein McpQ Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
G3XDA3 1.03e-18 90 28 8 331 1 ctpH Methyl-accepting chemotaxis protein CtpH Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9I3F6 1.38e-18 89 38 3 167 1 aer Methyl-accepting chemotaxis protein Aer Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9HUB1 1.5e-18 89 31 8 308 1 mcpK Methyl-accepting chemotaxis protein McpK Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
B0R474 1.48e-17 87 29 4 240 1 htr18 Transducer protein Htr18 Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Q9HP84 2.82e-17 86 27 6 299 3 cosT Transducer protein CosT Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
B0R6A7 2.82e-17 86 27 6 299 1 cosT Transducer protein CosT Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
B0R9Z1 6.88e-17 84 30 3 232 1 car Transducer protein Car Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Q88E10 1.2e-16 84 32 7 240 1 mcpS Methyl-accepting chemotaxis protein McpS Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q9I3S1 2.39e-16 82 38 3 133 1 bdlA Biofilm dispersion protein BdlA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
B0R367 3.18e-16 82 27 10 360 1 mpcT Transducer protein MpcT Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Q9HPR6 3.86e-16 82 26 3 266 3 hemAT Heme-based aerotactic transducer HemAT Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
Q88R14 4.3e-16 82 31 5 228 1 mcpH Methyl-accepting chemotaxis protein McpH Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5W2C8 8.82e-16 81 29 4 227 2 pcaY Methyl-accepting chemotaxis protein PcaY Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
P42257 9.09e-16 81 32 2 178 1 pilJ Protein PilJ Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q88JK6 1.03e-15 81 29 4 227 1 pcaY Methyl-accepting chemotaxis protein PcaY Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q9HUW6 1.34e-15 80 36 4 179 1 ctpL Methyl-accepting chemotaxis protein CtpL Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P39209 1.57e-15 80 27 4 287 3 tlpC Methyl-accepting chemotaxis protein TlpC Bacillus subtilis (strain 168)
B0R6I4 1.85e-15 80 30 7 264 1 basT Transducer protein BasT Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Q9I6V2 1.3e-14 77 39 2 110 1 mcpA Methyl-accepting chemotaxis protein McpA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q88NI1 1.32e-14 78 29 5 232 1 mcpU Methyl-accepting chemotaxis protein McpU Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
O07621 2.64e-14 76 28 2 164 1 hemAT Heme-based aerotactic transducer HemAT Bacillus subtilis (strain 168)
Q88IY8 2.84e-14 77 39 2 140 1 mcpP Methyl-accepting chemotaxis protein McpP Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q9WYR0 3.98e-14 76 34 2 170 1 mcp1 Methyl-accepting chemotaxis protein 1 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
B0R5T0 4.48e-14 76 24 4 288 1 htr8 Transducer protein Htr8 Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Q9HQ00 4.79e-14 75 29 0 168 3 htr9 Halobacterial transducer protein 9 Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
Q9R9U8 7.54e-14 75 37 2 129 3 alkN Putative methyl-accepting chemotaxis AlkN Pseudomonas oleovorans
Q9Z429 8.87e-14 75 31 6 211 3 nahY Methyl-accepting chemotaxis protein NahY Pseudomonas putida
Q2W8M7 1.5e-13 74 26 3 255 1 amb0994 Methyl-accepting chemotaxis protein Amb0994 Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
P35841 1.51e-13 74 28 4 234 3 dcrA Chemoreceptor protein A Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
P0DMI3 2.12e-13 74 24 10 366 1 htr1 Sensory rhodopsin I transducer Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
B0R632 2.12e-13 74 24 10 366 1 htr1 Sensory rhodopsin I transducer Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Q9X0N0 2.41e-13 73 30 2 182 1 mcp3 Methyl-accepting chemotaxis protein 3 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
O32239 4.69e-13 73 27 4 256 3 yvaQ Putative sensory transducer protein YvaQ Bacillus subtilis (strain 168)
Q0VTI9 4.88e-13 73 40 1 101 3 ABO_0106 Putative methyl-accepting chemotaxis AlkN Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q5V5V4 5.66e-13 73 25 3 271 2 htr2 Sensory rhodopsin II transducer Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
Q9HP81 5.69e-13 73 34 4 158 3 htr2 Sensory rhodopsin II transducer Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
B0R6B1 5.69e-13 73 34 4 158 1 htr2 Sensory rhodopsin II transducer Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Q2W4T8 8.51e-13 72 31 2 158 1 amb2333 Methyl-accepting chemotaxis protein Amb2333 Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q6HP15 1.15e-12 72 32 0 150 3 BT9727_0355 Probable methyl-accepting chemotaxis protein BT9727_0355 Bacillus thuringiensis subsp. konkukian (strain 97-27)
P42258 2.19e-12 70 29 2 175 3 htrII Sensory rhodopsin II transducer (Fragment) Haloarcula vallismortis
B0R461 2.95e-12 70 26 3 269 1 htr6 Transducer protein Htr6 Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Q5UXM8 5.28e-12 70 28 6 253 1 htr1 Sensory rhodopsin I transducer Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
O06477 5.36e-12 68 34 2 126 2 yfmS Putative sensory transducer protein YfmS Bacillus subtilis (strain 168)
A5F389 7.91e-12 69 48 0 68 3 tcpI Toxin coregulated pilus biosynthesis protein I Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
P0C6D8 8.59e-12 69 48 0 68 3 tcpI Toxin coregulated pilus biosynthesis protein I Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
B0R4N9 1.16e-11 68 29 2 169 1 htr13 Transducer protein Htr13 Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
P0DMI4 1.52e-11 68 32 3 160 3 htr4 Transducer protein Htr4 Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
B0R470 1.52e-11 68 32 3 160 1 htr4 Transducer protein Htr4 Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
P0DMI5 2.06e-11 68 27 4 281 3 htr7 Transducer protein Htr7 Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
B0R6A6 2.06e-11 68 27 4 281 1 htr7 Transducer protein Htr7 Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
P42259 6.11e-11 66 26 7 282 1 htr2 Sensory rhodopsin II transducer Natronomonas pharaonis

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS17630
Feature type CDS
Gene -
Product methyl-accepting chemotaxis protein
Location 166417 - 167397 (strand: -1)
Length 981 (nucleotides) / 326 (amino acids)

Contig

Accession term accessions NZ_VXKB01000007 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 196482 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2947
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF00015 Methyl-accepting chemotaxis protein (MCP) signalling domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0840 Signal transduction mechanisms (T) T Methyl-accepting chemotaxis protein (MCP)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03406 methyl-accepting chemotaxis protein Two-component system
Bacterial chemotaxis		 -

Protein Sequence

MPINAVKNSIDEVNAGNLSVRIPEFGNNCAGRLIPGANQLAESISVLVTEIRTSSDSASVLSEQLAMRSFELSAKTEQQSAMLIETSANMEEIAAGTKNNADNTVLVSKHAQEATLFAGRGGDLMANVATNMQSINKCTGKMTEIITLIDSIAFQTNILALNAAVEAARAGEHGRGFTVVAGEVRNLAHRSSESAKNIKALIDVTTGNVKQGTDIVAEAEENMNKIVQGAELVNGLMAQISVSTQQQQQGIEQIASALSELEQATQGSVMIADELAGSSDELKMQVAELQSRTRDFHLTASDKKPVPSDPVFKAGKRLQVSHFTGH

Flanking regions ( +/- flanking 50bp)

GTGTTTTTACGTTTATCTCATCCTGGATTTACATCACTAAATATTTAGTTATGCCAATCAATGCCGTAAAAAACAGTATTGATGAGGTCAATGCCGGTAACTTGTCTGTGCGTATCCCTGAGTTTGGTAATAACTGTGCCGGTCGTTTGATCCCCGGTGCAAACCAACTTGCGGAAAGTATCTCAGTGTTGGTGACGGAGATCCGCACCTCTTCTGATTCTGCATCGGTATTATCAGAGCAGTTAGCTATGCGCAGCTTTGAGTTATCCGCCAAGACAGAGCAACAATCTGCGATGTTGATTGAAACCTCTGCCAATATGGAAGAAATTGCAGCAGGAACAAAGAATAATGCAGATAACACGGTGCTTGTCAGCAAGCATGCACAGGAAGCGACTCTGTTTGCCGGGCGTGGCGGTGATTTGATGGCAAATGTTGCTACGAATATGCAATCGATTAATAAATGCACGGGTAAGATGACAGAAATTATCACACTAATCGATTCAATCGCTTTCCAGACCAATATTCTGGCATTGAATGCGGCAGTTGAAGCCGCGCGTGCCGGCGAGCACGGAAGAGGATTTACGGTTGTCGCCGGTGAAGTCAGGAACCTGGCTCACCGCAGTTCTGAATCAGCAAAAAATATTAAGGCGCTGATTGATGTCACCACCGGGAATGTAAAACAGGGTACGGATATTGTTGCGGAAGCCGAAGAAAATATGAATAAGATTGTTCAGGGCGCGGAGTTAGTTAATGGATTAATGGCACAAATCTCAGTCTCCACCCAGCAGCAGCAGCAGGGAATTGAACAAATTGCTTCTGCGCTTTCAGAGTTGGAGCAGGCAACACAAGGCAGTGTGATGATAGCCGATGAACTGGCCGGCTCTTCTGATGAGCTGAAAATGCAGGTTGCTGAGCTGCAATCCCGGACCCGTGATTTTCACCTGACGGCATCCGATAAGAAACCAGTGCCTTCAGATCCGGTATTCAAAGCCGGGAAACGCTTGCAGGTATCGCATTTCACCGGACATTGATTATACCCTTATTCATGCAAACAGCAGGTTCACATACTTGTGTATGCTCC