Homologs in group_81

Help

11 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_04800 FBDBKF_04800 80.7 Morganella morganii S1 uraA Xanthine/uracil permease
FBDBKF_16205 FBDBKF_16205 96.4 Morganella morganii S1 pbuX Xanthine/uracil permease
EHELCC_06090 EHELCC_06090 80.7 Morganella morganii S2 uraA Xanthine/uracil permease
EHELCC_16240 EHELCC_16240 96.4 Morganella morganii S2 pbuX Xanthine/uracil permease
NLDBIP_06410 NLDBIP_06410 80.7 Morganella morganii S4 uraA Xanthine/uracil permease
NLDBIP_17100 NLDBIP_17100 96.4 Morganella morganii S4 pbuX Xanthine/uracil permease
LHKJJB_03290 LHKJJB_03290 80.7 Morganella morganii S3 uraA Xanthine/uracil permease
LHKJJB_17020 LHKJJB_17020 96.4 Morganella morganii S3 pbuX Xanthine/uracil permease
HKOGLL_06765 HKOGLL_06765 80.7 Morganella morganii S5 uraA Xanthine/uracil permease
HKOGLL_16820 HKOGLL_16820 96.4 Morganella morganii S5 pbuX Xanthine/uracil permease
F4V73_RS09270 F4V73_RS09270 78.8 Morganella psychrotolerans - nucleobase:cation symporter-2 family protein

Distribution of the homologs in the orthogroup group_81

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_81

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P67444 0.0 695 79 0 453 1 xanQ Xanthine permease XanQ Escherichia coli (strain K12)
P67445 0.0 695 79 0 453 3 xanQ Xanthine permease XanQ Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P67446 0.0 695 79 0 453 3 xanQ Xanthine permease XanQ Escherichia coli O157:H7
P0AGN2 6.25e-117 353 42 1 448 3 xanP Xanthine permease XanP Shigella flexneri
P0AGM9 6.25e-117 353 42 1 448 1 xanP Xanthine permease XanP Escherichia coli (strain K12)
P0AGN0 6.25e-117 353 42 1 448 3 xanP Xanthine permease XanP Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AGN1 6.25e-117 353 42 1 448 3 xanP Xanthine permease XanP Escherichia coli O157:H7
P50487 2.46e-66 223 31 5 460 3 cpx Putative purine permease CPE0397 Clostridium perfringens (strain 13 / Type A)
A0A2A5JY22 6.11e-63 213 35 5 428 1 PL1_3014 Nucleobase transporter PlUacP Paenibacillus larvae subsp. larvae (strain NRRL B-3650 / LMG 16245)
Q9HE12 3.34e-62 215 32 11 507 3 SPAC1399.01c Putative purine permease C1399.01c Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P42086 4.91e-59 203 33 6 439 3 pbuX Xanthine permease Bacillus subtilis (strain 168)
Q07307 6.1e-50 182 29 9 501 1 uapA Uric acid-xanthine permease Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
O32140 7.92e-47 170 30 8 450 2 pucK Uric acid permease PucK Bacillus subtilis (strain 168)
P48777 1.09e-46 173 30 8 452 2 uapC Purine permease Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
O32139 3.33e-41 155 30 6 451 2 pucJ Uric acid permease PucJ Bacillus subtilis (strain 168)
Q46821 6.57e-38 147 28 11 453 1 uacT Uric acid transporter UacT Escherichia coli (strain K12)
A0A2A5K1W4 2.07e-21 99 27 10 397 1 PL1_0655 Uracil permease Paenibacillus larvae subsp. larvae (strain NRRL B-3650 / LMG 16245)
P75892 5.92e-19 92 27 15 427 1 rutG Putative pyrimidine permease RutG Escherichia coli (strain K12)
P39766 2.02e-17 87 28 6 253 1 pyrP Uracil permease Bacillus subtilis (strain 168)
Q9CPL9 1.13e-15 82 25 5 287 3 uraA Probable uracil permease Pasteurella multocida (strain Pm70)
P41006 2.23e-15 81 24 17 468 3 pyrP Uracil permease Bacillus caldolyticus
P45117 1.97e-14 78 25 5 270 3 uraA Probable uracil permease Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0AGM7 1.11e-10 67 24 12 410 1 uraA Uracil permease Escherichia coli (strain K12)
P0AGM8 1.11e-10 67 24 12 410 1 uraA Uracil permease Escherichia coli O157:H7
B0JZG0 3.79e-08 59 22 19 527 2 slc23a2 Solute carrier family 23 member 2 Xenopus tropicalis
Q9Z2J0 5.36e-08 58 22 17 512 1 Slc23a1 Solute carrier family 23 member 1 Mus musculus
Q94C70 5.73e-08 58 23 15 438 2 NAT2 Nucleobase-ascorbate transporter 2 Arabidopsis thaliana
Q9WTW7 8.22e-08 58 23 19 524 2 Slc23a1 Solute carrier family 23 member 1 Rattus norvegicus
Q9UHI7 1.54e-07 57 22 12 435 1 SLC23A1 Solute carrier family 23 member 1 Homo sapiens
Q41760 1.56e-07 57 23 12 452 1 LPE1 Nucleobase-ascorbate transporter LPE1 Zea mays
Q3E7D0 3.25e-07 56 24 15 462 1 NAT12 Nucleobase-ascorbate transporter 12 Arabidopsis thaliana
Q9EPR4 3.62e-07 56 24 22 502 1 Slc23a2 Solute carrier family 23 member 2 Mus musculus
Q6SZ87 6.34e-07 55 21 14 452 2 NAT11 Nucleobase-ascorbate transporter 11 Arabidopsis thaliana
Q27GI3 8.13e-07 55 21 14 442 2 NAT6 Nucleobase-ascorbate transporter 6 Arabidopsis thaliana
Q9WTW8 9.42e-07 55 23 21 496 1 Slc23a2 Solute carrier family 23 member 2 Rattus norvegicus
Q9UGH3 1.42e-06 54 23 19 496 1 SLC23A2 Solute carrier family 23 member 2 Homo sapiens
Q8GZD4 6.11e-06 52 25 5 182 2 NAT3 Nucleobase-ascorbate transporter 3 Arabidopsis thaliana
Q8VZQ5 6.35e-05 48 20 15 449 2 NAT8 Nucleobase-ascorbate transporter 8 Arabidopsis thaliana
Q0WPE9 0.000124 48 24 4 181 2 NAT7 Nucleobase-ascorbate transporter 7 Arabidopsis thaliana
P93039 0.000485 46 24 5 183 2 NAT4 Nucleobase-ascorbate transporter 4 Arabidopsis thaliana
Q8RWE9 0.00052 46 23 4 178 2 NAT5 Nucleobase-ascorbate transporter 5 Arabidopsis thaliana
P77328 0.000751 45 20 10 420 1 ybbY Putative purine permease YbbY Escherichia coli (strain K12)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS17400
Feature type CDS
Gene -
Product nucleobase:cation symporter-2 family protein
Location 110213 - 111613 (strand: -1)
Length 1401 (nucleotides) / 466 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000007
Length 196482 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_81
Orthogroup size 12
N. genomes 6

Actions

Genomic region

Domains

PF00860 Permease family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2233 Nucleotide transport and metabolism (F) F Xanthine/uracil permease

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K16346 xanthine permease XanQ - -

Protein Sequence

MSDQQSTTSDLIYQLEDKPPFLQAIIGAVTHLLAIFVPMVTPALIVGTALQLSPETNAYLVSMAMIASGVGTWLQVNRYGMVGSGLLSIQSVNFSFVTVMIAIGTSMRADGISEELLLSTIFGISFAGAFLVVGSSFILPYLRRVITPTVSGVVVLMIGLSLIKVGIIDFGGGFSAKSSGTFGDYQNIGVGLLVLLVVIGFNCCKSPLLRMGGIAIGLIVGYICALFLGMVDFSQMSKAAFITIPVPFKYGFSFNFGHFLVVAIIYLLSVLEAVGDLTATALVSGQKIQGQEFQSRLKGGVMADGIVSVAASAMSSLPLTTFAQNNGVIQMTGVASRHVGKIIAVILVILGLFPGIGWFFTTIPAPVLGGAMTLMFSMIAIAGIRIILSNGLRRRETLIVATSLGLGLGVSYDPAVFHVLPPSLYALAENPICIGGITAIILNLIIPVSKEAEPDDVEEIAPEKEV

Flanking regions ( +/- flanking 50bp)

ATAGTTAAAAATGAGTTCAGATAGTCAAATTCACTTACAGGAGAGAAGAGATGTCTGATCAACAAAGTACAACGTCAGATCTTATCTACCAACTTGAAGACAAACCCCCGTTTTTACAGGCAATTATTGGTGCAGTAACACATTTACTCGCTATTTTTGTTCCTATGGTTACACCGGCTCTGATTGTCGGTACTGCACTGCAATTATCACCGGAAACCAATGCATATCTCGTCTCAATGGCGATGATTGCCTCCGGAGTGGGGACATGGTTGCAGGTGAACCGCTACGGAATGGTCGGCTCAGGGTTGCTATCCATTCAATCTGTTAACTTTTCATTCGTCACCGTGATGATTGCCATCGGAACCAGCATGCGGGCTGATGGTATAAGTGAAGAGTTATTGTTATCCACCATTTTTGGTATCTCGTTCGCCGGGGCATTTTTAGTTGTGGGATCGTCTTTTATCTTGCCCTATCTGCGCCGTGTAATAACCCCGACTGTCAGCGGTGTTGTGGTTCTGATGATCGGGCTGAGTCTGATTAAAGTCGGTATTATAGATTTCGGTGGTGGTTTCTCAGCCAAATCCTCAGGCACATTCGGCGATTACCAGAATATAGGTGTCGGATTATTAGTATTGCTGGTGGTGATTGGTTTTAACTGCTGCAAAAGCCCGCTGCTGCGCATGGGCGGGATCGCTATCGGGTTAATTGTCGGTTATATCTGCGCGCTGTTTCTCGGAATGGTTGATTTCAGTCAGATGAGTAAAGCGGCATTTATCACCATCCCTGTCCCGTTTAAATATGGATTCTCATTTAATTTCGGACATTTTCTTGTTGTTGCGATTATTTATCTGTTAAGTGTGCTGGAAGCGGTCGGGGATTTAACTGCCACCGCGCTGGTTTCCGGGCAGAAAATTCAGGGGCAGGAATTTCAGTCCCGTCTGAAAGGCGGCGTGATGGCAGACGGAATAGTTTCTGTTGCTGCATCCGCTATGAGTTCGCTGCCGCTGACAACCTTCGCGCAGAATAACGGTGTTATCCAGATGACCGGCGTGGCATCCAGGCATGTGGGGAAAATTATTGCAGTGATTCTGGTTATCCTCGGCTTATTTCCGGGCATTGGCTGGTTTTTCACCACCATTCCGGCGCCGGTACTGGGTGGGGCAATGACACTGATGTTTTCCATGATAGCCATCGCCGGTATCCGTATTATTTTGTCAAATGGTCTGCGCCGCCGCGAAACCCTGATTGTTGCAACCTCGCTGGGTCTGGGGCTGGGCGTGTCTTATGACCCCGCTGTATTCCATGTTCTGCCCCCGTCACTCTACGCATTAGCGGAAAACCCGATTTGTATCGGGGGGATCACCGCTATTATTCTCAATCTAATCATCCCCGTCAGTAAGGAAGCCGAACCTGATGATGTGGAGGAAATAGCGCCGGAAAAAGAGGTTTAACAAAAAGCCGGTCAATACACGATATTGACCGGCCCGGTATTTGTTTTGAG