Homologs in group_1762

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_12265 FBDBKF_12265 90.0 Morganella morganii S1 zapB Cell division protein ZapB, interacts with FtsZ
EHELCC_14040 EHELCC_14040 90.0 Morganella morganii S2 zapB Cell division protein ZapB, interacts with FtsZ
NLDBIP_15135 NLDBIP_15135 90.0 Morganella morganii S4 zapB Cell division protein ZapB, interacts with FtsZ
LHKJJB_15475 LHKJJB_15475 90.0 Morganella morganii S3 zapB Cell division protein ZapB, interacts with FtsZ
HKOGLL_14595 HKOGLL_14595 90.0 Morganella morganii S5 zapB Cell division protein ZapB, interacts with FtsZ
PMI_RS15885 PMI_RS15885 76.2 Proteus mirabilis HI4320 zapB cell division protein ZapB

Distribution of the homologs in the orthogroup group_1762

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1762

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7MYB8 5.81e-37 121 77 0 80 3 zapB Cell division protein ZapB Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B4F168 4.24e-36 119 76 0 80 3 zapB Cell division protein ZapB Proteus mirabilis (strain HI4320)
B2VES1 7.53e-36 119 75 0 79 3 zapB Cell division protein ZapB Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A8GL99 1.07e-35 118 73 0 79 3 zapB Cell division protein ZapB Serratia proteamaculans (strain 568)
B1JQ83 2.21e-35 117 75 0 79 3 zapB Cell division protein ZapB Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66G93 2.21e-35 117 75 0 79 3 zapB Cell division protein ZapB Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TS94 2.21e-35 117 75 0 79 3 zapB Cell division protein ZapB Yersinia pestis (strain Pestoides F)
Q1CD47 2.21e-35 117 75 0 79 3 zapB Cell division protein ZapB Yersinia pestis bv. Antiqua (strain Nepal516)
A9R6B7 2.21e-35 117 75 0 79 3 zapB Cell division protein ZapB Yersinia pestis bv. Antiqua (strain Angola)
Q7CLC9 2.21e-35 117 75 0 79 3 zapB Cell division protein ZapB Yersinia pestis
B2JZB8 2.21e-35 117 75 0 79 3 zapB Cell division protein ZapB Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C2B1 2.21e-35 117 75 0 79 3 zapB Cell division protein ZapB Yersinia pestis bv. Antiqua (strain Antiqua)
A7FCX5 2.21e-35 117 75 0 79 3 zapB Cell division protein ZapB Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q6CZ88 3.42e-35 117 75 0 79 3 zapB Cell division protein ZapB Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A1JI05 6.06e-35 116 75 0 79 3 zapB Cell division protein ZapB Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
C6DHM3 6.69e-35 116 75 0 79 3 zapB Cell division protein ZapB Pectobacterium carotovorum subsp. carotovorum (strain PC1)
C5BB78 8.02e-35 116 75 0 79 3 zapB Cell division protein ZapB Edwardsiella ictaluri (strain 93-146)
B2TWC4 7.31e-34 114 74 0 79 3 zapB Cell division protein ZapB Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B6I4S1 7.31e-34 114 74 0 79 3 zapB Cell division protein ZapB Escherichia coli (strain SE11)
B1IVF1 7.31e-34 114 74 0 79 3 zapB Cell division protein ZapB Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
B5YZ66 7.31e-34 114 74 0 79 3 zapB Cell division protein ZapB Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q3YV50 8e-34 114 74 0 79 3 zapB Cell division protein ZapB Shigella sonnei (strain Ss046)
P0AF39 8e-34 114 74 0 79 3 zapB Cell division protein ZapB Shigella flexneri
Q0SY61 8e-34 114 74 0 79 3 zapB Cell division protein ZapB Shigella flexneri serotype 5b (strain 8401)
Q32A94 8e-34 114 74 0 79 3 zapB Cell division protein ZapB Shigella dysenteriae serotype 1 (strain Sd197)
Q31U62 8e-34 114 74 0 79 3 zapB Cell division protein ZapB Shigella boydii serotype 4 (strain Sb227)
B7LUS6 8e-34 114 74 0 79 3 zapB Cell division protein ZapB Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1R3Z0 8e-34 114 74 0 79 3 zapB Cell division protein ZapB Escherichia coli (strain UTI89 / UPEC)
B1LNN1 8e-34 114 74 0 79 3 zapB Cell division protein ZapB Escherichia coli (strain SMS-3-5 / SECEC)
B7NFM5 8e-34 114 74 0 79 3 zapB Cell division protein ZapB Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0AF36 8e-34 114 74 0 79 1 zapB Cell division protein ZapB Escherichia coli (strain K12)
P0AF37 8e-34 114 74 0 79 3 zapB Cell division protein ZapB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TAD6 8e-34 114 74 0 79 3 zapB Cell division protein ZapB Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A8A734 8e-34 114 74 0 79 3 zapB Cell division protein ZapB Escherichia coli O9:H4 (strain HS)
B1XB94 8e-34 114 74 0 79 3 zapB Cell division protein ZapB Escherichia coli (strain K12 / DH10B)
C5A095 8e-34 114 74 0 79 3 zapB Cell division protein ZapB Escherichia coli (strain K12 / MC4100 / BW2952)
B7M6X9 8e-34 114 74 0 79 3 zapB Cell division protein ZapB Escherichia coli O8 (strain IAI1)
B7N2R9 8e-34 114 74 0 79 3 zapB Cell division protein ZapB Escherichia coli O81 (strain ED1a)
B7NU79 8e-34 114 74 0 79 3 zapB Cell division protein ZapB Escherichia coli O7:K1 (strain IAI39 / ExPEC)
P0AF38 8e-34 114 74 0 79 3 zapB Cell division protein ZapB Escherichia coli O157:H7
B7LA21 8e-34 114 74 0 79 3 zapB Cell division protein ZapB Escherichia coli (strain 55989 / EAEC)
B7MI60 8e-34 114 74 0 79 3 zapB Cell division protein ZapB Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UNP8 8e-34 114 74 0 79 3 zapB Cell division protein ZapB Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZUE3 8e-34 114 74 0 79 3 zapB Cell division protein ZapB Escherichia coli O139:H28 (strain E24377A / ETEC)
Q2NQX9 1.59e-33 113 73 0 79 3 zapB Cell division protein ZapB Sodalis glossinidius (strain morsitans)
Q8ZKP1 3.15e-32 109 72 0 79 3 zapB Cell division protein ZapB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TPU9 3.15e-32 109 72 0 79 3 zapB Cell division protein ZapB Salmonella schwarzengrund (strain CVM19633)
B5BJK5 3.15e-32 109 72 0 79 3 zapB Cell division protein ZapB Salmonella paratyphi A (strain AKU_12601)
C0Q438 3.15e-32 109 72 0 79 3 zapB Cell division protein ZapB Salmonella paratyphi C (strain RKS4594)
A9MZH7 3.15e-32 109 72 0 79 3 zapB Cell division protein ZapB Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PIS1 3.15e-32 109 72 0 79 3 zapB Cell division protein ZapB Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T0T4 3.15e-32 109 72 0 79 3 zapB Cell division protein ZapB Salmonella newport (strain SL254)
B4TCM4 3.15e-32 109 72 0 79 3 zapB Cell division protein ZapB Salmonella heidelberg (strain SL476)
B5RF83 3.15e-32 109 72 0 79 3 zapB Cell division protein ZapB Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QXL7 3.15e-32 109 72 0 79 3 zapB Cell division protein ZapB Salmonella enteritidis PT4 (strain P125109)
B5FPT6 3.15e-32 109 72 0 79 3 zapB Cell division protein ZapB Salmonella dublin (strain CT_02021853)
Q57HC9 3.15e-32 109 72 0 79 3 zapB Cell division protein ZapB Salmonella choleraesuis (strain SC-B67)
B5F0R9 3.15e-32 109 72 0 79 3 zapB Cell division protein ZapB Salmonella agona (strain SL483)
A9MI38 4.06e-32 109 72 0 79 3 zapB Cell division protein ZapB Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q8Z2Y8 1.51e-31 108 72 0 79 3 zapB Cell division protein ZapB Salmonella typhi
A7ML67 4.74e-31 106 68 0 79 3 zapB Cell division protein ZapB Cronobacter sakazakii (strain ATCC BAA-894)
A8AKZ7 5.65e-31 106 69 0 79 3 zapB Cell division protein ZapB Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A6TFR0 1.18e-30 105 70 0 79 3 zapB Cell division protein ZapB Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A4WG70 3.69e-30 104 68 0 79 3 zapB Cell division protein ZapB Enterobacter sp. (strain 638)
B5XTD6 5.01e-30 104 69 0 79 3 zapB Cell division protein ZapB Klebsiella pneumoniae (strain 342)
Q7MH53 3.47e-24 89 57 0 80 3 zapB Cell division protein ZapB Vibrio vulnificus (strain YJ016)
Q8DCP7 3.47e-24 89 57 0 80 3 zapB Cell division protein ZapB Vibrio vulnificus (strain CMCP6)
Q6LVI6 3.73e-24 89 56 0 80 3 zapB Cell division protein ZapB Photobacterium profundum (strain SS9)
C3LSB5 3.14e-23 87 55 0 80 3 zapB Cell division protein ZapB Vibrio cholerae serotype O1 (strain M66-2)
Q9KNP5 3.14e-23 87 55 0 80 3 zapB Cell division protein ZapB Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F4W4 3.14e-23 87 55 0 80 3 zapB Cell division protein ZapB Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
A7MWJ1 3.17e-23 87 55 0 80 3 zapB Cell division protein ZapB Vibrio campbellii (strain ATCC BAA-1116)
B7VLN0 1.02e-20 80 50 0 80 3 zapB Cell division protein ZapB Vibrio atlanticus (strain LGP32)
Q65QA0 4.71e-19 76 51 1 79 3 zapB Cell division protein ZapB Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q9CKW8 1.02e-18 75 53 2 79 3 zapB Cell division protein ZapB Pasteurella multocida (strain Pm70)
A6VLC4 3e-18 74 50 1 79 3 zapB Cell division protein ZapB Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q5E8E1 4.8e-18 73 46 0 80 3 zapB Cell division protein ZapB Aliivibrio fischeri (strain ATCC 700601 / ES114)
B0UWH5 5.24e-18 73 51 2 79 3 zapB Cell division protein ZapB Histophilus somni (strain 2336)
Q0I5W2 5.24e-18 73 51 2 79 3 zapB Cell division protein ZapB Histophilus somni (strain 129Pt)
A0KER2 5.76e-18 73 53 1 77 3 zapB Cell division protein ZapB Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
C4LBS8 1.47e-17 72 50 1 77 3 zapB Cell division protein ZapB Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
P44812 1.55e-17 72 48 1 79 1 zapB Cell division protein ZapB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UHF7 1.55e-17 72 48 1 79 3 zapB Cell division protein ZapB Haemophilus influenzae (strain PittGG)
A5UE63 1.55e-17 72 48 1 79 3 zapB Cell division protein ZapB Haemophilus influenzae (strain PittEE)
Q4QMP8 1.55e-17 72 48 1 79 3 zapB Cell division protein ZapB Haemophilus influenzae (strain 86-028NP)
B6EPL9 1.84e-17 72 45 0 80 3 zapB Cell division protein ZapB Aliivibrio salmonicida (strain LFI1238)
Q87T24 3.36e-17 71 55 0 80 3 zapB Cell division protein ZapB Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B3H152 5.22e-17 71 48 1 79 3 zapB Cell division protein ZapB Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3MZY9 5.22e-17 71 48 1 79 3 zapB Cell division protein ZapB Actinobacillus pleuropneumoniae serotype 5b (strain L20)
C4K415 1.24e-16 70 45 0 79 3 zapB Cell division protein ZapB Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
A4STA4 1.89e-16 69 50 1 77 3 zapB Cell division protein ZapB Aeromonas salmonicida (strain A449)
Q7VLH3 3.32e-16 68 48 1 79 3 zapB Cell division protein ZapB Haemophilus ducreyi (strain 35000HP / ATCC 700724)
A1SZR9 1.48e-11 57 41 1 80 3 zapB Cell division protein ZapB Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q088P1 5.84e-10 53 35 1 78 3 zapB Cell division protein ZapB Shewanella frigidimarina (strain NCIMB 400)
Q1QT72 3.18e-09 51 37 1 80 3 zapB Cell division protein ZapB Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
A3Q9J1 3.01e-05 41 38 1 78 3 zapB Cell division protein ZapB Shewanella loihica (strain ATCC BAA-1088 / PV-4)
B1KPD1 0.000255 38 37 2 78 3 zapB Cell division protein ZapB Shewanella woodyi (strain ATCC 51908 / MS32)
A1SAW5 0.000893 37 37 1 78 3 zapB Cell division protein ZapB Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS17095
Feature type CDS
Gene zapB
Product cell division protein ZapB
Location 47744 - 47986 (strand: -1)
Length 243 (nucleotides) / 80 (amino acids)

Contig

Accession term accessions NZ_VXKB01000007 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 196482 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1762
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF06005 Cell division protein ZapB

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3074 Cell cycle control, cell division, chromosome partitioning (D) D Cell division protein ZapB, interacts with FtsZ

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K09892 cell division protein ZapB - -

Protein Sequence

MSFEVFEKLEAKVQQAIDTITLLQMEIDELKETNTNLNREVQNATGQHETLVRENEQLKQELNGWQERLRALLGRMDDVQ

Flanking regions ( +/- flanking 50bp)

TTGATAACACCTACTTACAATCAGTGCATCGCTTACATGGAGGACGCAAGATGTCATTTGAAGTATTTGAAAAGCTGGAAGCAAAAGTCCAGCAGGCAATCGACACCATCACACTGTTACAGATGGAAATCGACGAATTAAAAGAAACAAACACTAACCTCAACCGGGAAGTGCAGAATGCAACGGGTCAGCATGAAACGCTGGTACGTGAGAATGAGCAGCTGAAGCAGGAACTGAACGGCTGGCAGGAGCGTCTGAGAGCGTTGTTGGGTCGTATGGATGACGTCCAATAATTACGCGTCATCCTTCGCTCTGTGGCTGCGTTGGCTTTGTTCGTCCGCCC