Homologs in group_2953

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_15720 FBDBKF_15720 30.8 Morganella morganii S1 merP mercury resistance system periplasmic binding protein MerP
EHELCC_16075 EHELCC_16075 30.8 Morganella morganii S2 merP mercury resistance system periplasmic binding protein MerP
NLDBIP_16290 NLDBIP_16290 30.8 Morganella morganii S4 merP mercury resistance system periplasmic binding protein MerP
LHKJJB_16510 LHKJJB_16510 30.8 Morganella morganii S3 merP mercury resistance system periplasmic binding protein MerP
HKOGLL_16280 HKOGLL_16280 30.8 Morganella morganii S5 merP mercury resistance system periplasmic binding protein MerP

Distribution of the homologs in the orthogroup group_2953

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2953

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q51770 0.000437 38 31 1 64 3 merP Mercuric transport protein periplasmic component Pseudomonas fluorescens
P04131 0.000643 37 29 1 64 3 merP Mercuric transport protein periplasmic component Pseudomonas aeruginosa

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS17000
Feature type CDS
Gene -
Product heavy-metal-associated domain-containing protein
Location 23778 - 23975 (strand: -1)
Length 198 (nucleotides) / 65 (amino acids)

Contig

Accession term accessions NZ_VXKB01000007 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 196482 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2953
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF00403 Heavy-metal-associated domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2608 Inorganic ion transport and metabolism (P) P Copper chaperone CopZ

Protein Sequence

MISFTIPNMTCGGCAKSVTKALSDVDGQALIETKPATRTVKIKSNIAESTFRTALSAAGYPADPV

Flanking regions ( +/- flanking 50bp)

CTGGTAAGCCTTACCTTAATTATGAAATTACGAATAATCAGGAGAGAAAAATGATTAGTTTTACTATACCGAACATGACTTGCGGCGGTTGTGCTAAATCAGTGACAAAAGCATTATCAGATGTGGATGGGCAGGCACTGATAGAGACTAAGCCGGCAACAAGAACAGTGAAAATTAAAAGTAATATCGCAGAAAGTACTTTCCGCACAGCACTCAGTGCTGCCGGATATCCGGCTGATCCGGTGTAATCCAAAATAATATTACTGCCGGGTTATTCCCTGTAAAAATGAATTTCCCG