Homologs in group_2264

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_17420 FBDBKF_17420 93.5 Morganella morganii S1 ahpC Alkyl hydroperoxide reductase subunit AhpC (peroxiredoxin)
EHELCC_17315 EHELCC_17315 93.5 Morganella morganii S2 ahpC Alkyl hydroperoxide reductase subunit AhpC (peroxiredoxin)
NLDBIP_17880 NLDBIP_17880 93.5 Morganella morganii S4 ahpC Alkyl hydroperoxide reductase subunit AhpC (peroxiredoxin)
LHKJJB_17800 LHKJJB_17800 93.5 Morganella morganii S3 ahpC Alkyl hydroperoxide reductase subunit AhpC (peroxiredoxin)
HKOGLL_17810 HKOGLL_17810 93.5 Morganella morganii S5 ahpC Alkyl hydroperoxide reductase subunit AhpC (peroxiredoxin)
PMI_RS00350 PMI_RS00350 85.5 Proteus mirabilis HI4320 - peroxiredoxin C

Distribution of the homologs in the orthogroup group_2264

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2264

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q8K9W0 2.36e-97 283 62 0 195 3 BUsg_176 Alkyl hydroperoxide reductase C Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P57279 5.3e-96 280 60 0 197 3 BU182 Alkyl hydroperoxide reductase C Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q89AS1 8.44e-90 265 55 0 199 3 bbp_171 Alkyl hydroperoxide reductase C Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
P21762 1.12e-86 256 61 1 199 1 ahpC Alkyl hydroperoxide reductase C Helicobacter pylori (strain ATCC 700392 / 26695)
P56876 1.42e-85 254 61 1 199 1 ahpC Alkyl hydroperoxide reductase C Helicobacter pylori (strain J99 / ATCC 700824)
Q96468 4.38e-62 194 45 1 193 2 BAS1 2-Cys peroxiredoxin BAS1, chloroplastic (Fragment) Hordeum vulgare
P80602 6.77e-62 194 45 1 193 1 TSA 2-Cys peroxiredoxin BAS1, chloroplastic (Fragment) Triticum aestivum
P0CB50 8.8e-61 191 45 2 194 1 PRDX1 Peroxiredoxin-1 Gallus gallus
Q6ER94 3.58e-60 191 44 2 192 1 BAS1 2-Cys peroxiredoxin BAS1, chloroplastic Oryza sativa subsp. japonica
Q9C5R8 8.79e-60 191 45 2 194 2 At5g06290 2-Cys peroxiredoxin BAS1-like, chloroplastic Arabidopsis thaliana
Q6DV14 7.61e-59 186 44 2 193 2 PRDX1 Peroxiredoxin-1 Gekko japonicus
A0A2Z5VKM8 1.02e-58 186 43 3 194 1 None 2-cysteine peroxiredoxin, chloroplastic Chattonella marina var. antiqua
Q555L5 1.8e-58 187 47 3 193 1 prdx4 Peroxiredoxin-4 Dictyostelium discoideum
Q26695 2.55e-58 184 48 2 186 2 None Thioredoxin peroxidase Trypanosoma brucei rhodesiense
P35700 2.78e-58 184 44 2 189 1 Prdx1 Peroxiredoxin-1 Mus musculus
Q9JKY1 2.85e-58 184 45 2 189 1 PRDX1 Peroxiredoxin-1 Cricetulus griseus
Q63716 3.9e-58 184 45 2 189 1 Prdx1 Peroxiredoxin-1 Rattus norvegicus
Q5E947 4.31e-58 184 44 2 193 2 PRDX1 Peroxiredoxin-1 Bos taurus
Q06830 4.7e-58 184 44 2 189 1 PRDX1 Peroxiredoxin-1 Homo sapiens
Q61171 6.11e-58 184 43 2 194 1 Prdx2 Peroxiredoxin-2 Mus musculus
Q8K3U7 7.36e-58 183 42 2 194 2 PRDX2 Peroxiredoxin-2 Cricetulus griseus
Q6B4U9 8.01e-58 183 44 2 189 1 PRDX1 Peroxiredoxin-1 Myotis lucifugus
Q2PFZ3 8.76e-58 183 43 2 194 2 PRDX2 Peroxiredoxin-2 Macaca fascicularis
P32119 8.76e-58 183 43 2 194 1 PRDX2 Peroxiredoxin-2 Homo sapiens
Q8T6C4 1.66e-57 182 43 3 193 2 TPX Thioredoxin peroxidase Echinococcus granulosus
Q55624 4.73e-57 181 43 3 192 3 sll0755 Putative peroxiredoxin sll0755 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P35704 6.87e-57 181 42 2 194 1 Prdx2 Peroxiredoxin-2 Rattus norvegicus
Q9NL98 2.31e-56 179 44 3 194 2 None Peroxiredoxin Ascaris suum
O08807 2.36e-56 182 45 3 192 1 Prdx4 Peroxiredoxin-4 Mus musculus
Q90384 2.92e-56 179 43 2 193 2 None Peroxiredoxin Cynops pyrrhogaster
Q9Z0V5 3.21e-56 182 45 3 192 2 Prdx4 Peroxiredoxin-4 Rattus norvegicus
O24364 4.63e-56 181 43 1 193 2 BAS1 2-Cys peroxiredoxin BAS1, chloroplastic Spinacia oleracea
P20108 5.85e-56 181 45 3 196 1 Prdx3 Thioredoxin-dependent peroxide reductase, mitochondrial Mus musculus
Q96291 6.68e-56 181 43 2 194 1 BAS1 2-Cys peroxiredoxin BAS1, chloroplastic Arabidopsis thaliana
Q9BGI2 1.38e-55 180 44 3 192 2 PRDX4 Peroxiredoxin-4 Bos taurus
Q9Z0V6 2.48e-55 179 44 3 196 1 Prdx3 Thioredoxin-dependent peroxide reductase, mitochondrial Rattus norvegicus
Q13162 4.67e-55 179 44 3 192 1 PRDX4 Peroxiredoxin-4 Homo sapiens
Q9VEJ0 7.47e-55 177 43 2 185 1 Prx3 Thioredoxin-dependent peroxide reductase, mitochondrial Drosophila melanogaster
Q9BGI3 9.33e-55 176 42 2 194 2 PRDX2 Peroxiredoxin-2 Bos taurus
Q9V3P0 2.71e-54 174 41 3 197 1 Prx2 Peroxiredoxin 2 Drosophila melanogaster
P30048 2.77e-54 176 44 3 192 1 PRDX3 Thioredoxin-dependent peroxide reductase, mitochondrial Homo sapiens
A0A0K3AUJ9 7.43e-54 173 44 3 194 1 prdx-2 Peroxiredoxin prdx-2 Caenorhabditis elegans
Q5REY3 1.1e-53 175 43 3 192 2 PRDX3 Thioredoxin-dependent peroxide reductase, mitochondrial Pongo abelii
Q9Y7F0 4.78e-53 171 42 2 193 2 TSA1 Peroxiredoxin TSA1-A Candida albicans (strain SC5314 / ATCC MYA-2876)
P0CU34 4.78e-53 171 42 2 193 2 TSA1B Peroxiredoxin TSA1-B Candida albicans (strain SC5314 / ATCC MYA-2876)
Q91191 5.23e-53 171 45 3 190 2 None Peroxiredoxin Oncorhynchus mykiss
Q17172 1.89e-52 169 43 3 194 2 tsa-2 Peroxiredoxin 2 Brugia malayi
P35705 2.38e-52 171 43 3 196 1 PRDX3 Thioredoxin-dependent peroxide reductase, mitochondrial Bos taurus
P48822 2.74e-52 170 43 4 193 2 TSA1 Peroxiredoxin 1 Brugia malayi
O74887 4.84e-52 168 45 3 179 1 tpx1 Peroxiredoxin tpx1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q21824 1.33e-51 168 42 2 188 3 prdx-3 Probable peroxiredoxin prdx-3 Caenorhabditis elegans
Q1XDL4 2.01e-51 167 41 4 193 3 ycf42 Putative peroxiredoxin ycf42 Neopyropia yezoensis
Q5RC63 2.71e-50 163 45 2 166 2 PRDX2 Peroxiredoxin-2 Pongo abelii
P51272 5.9e-50 163 39 4 191 3 ycf42 Putative peroxiredoxin ycf42 Porphyra purpurea
P91883 2.16e-49 162 39 2 188 2 None Thioredoxin peroxidase Fasciola hepatica
P34760 5.18e-49 160 40 2 191 1 TSA1 Peroxiredoxin TSA1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P19476 1.98e-48 160 38 2 190 1 None Putative peroxiredoxin Entamoeba histolytica (strain ATCC 30459 / HM-1:IMSS / ABRM)
O34564 8.54e-47 154 41 3 181 3 ykuU Putative peroxiredoxin YkuU Bacillus subtilis (strain 168)
P23161 4.39e-45 150 37 2 180 3 None Putative peroxiredoxin in rubredoxin operon Clostridium pasteurianum
Q04120 1.41e-44 149 38 2 191 1 TSA2 Peroxiredoxin TSA2 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q9L3Q5 3.05e-41 141 38 4 201 1 prxU Selenocysteine-containing peroxiredoxin PrxU Peptoclostridium acidaminophilum
P52552 1.19e-40 137 46 0 127 2 PRDX2 Peroxiredoxin-2 (Fragment) Sus scrofa
Q979N7 3.23e-40 139 35 2 196 3 TV1123 Peroxiredoxin Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1)
Q9HJL3 2.71e-39 136 36 2 191 3 Ta0954 Peroxiredoxin 2 Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165)
Q02UU0 1.23e-36 129 34 4 186 1 ahpC Alkyl hydroperoxide reductase C Pseudomonas aeruginosa (strain UCBPP-PA14)
P80239 2.23e-36 128 36 4 186 1 ahpC Alkyl hydroperoxide reductase C Bacillus subtilis (strain 168)
A0R1V9 2.48e-36 128 36 5 193 1 MSMEG_4891 Alkyl hydroperoxide reductase C Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
K0J4Q8 3.11e-36 128 40 2 155 1 ahpC Alkyl hydroperoxide reductase C Amphibacillus xylanus (strain ATCC 51415 / DSM 6626 / JCM 7361 / LMG 17667 / NBRC 15112 / Ep01)
Q4L376 9.72e-36 127 38 2 152 3 ahpC Alkyl hydroperoxide reductase C Staphylococcus haemolyticus (strain JCSC1435)
Q49UT8 7.9e-35 124 35 4 184 3 ahpC Alkyl hydroperoxide reductase C Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
O67024 1.64e-34 124 38 3 170 1 aq_858 Peroxiredoxin Aquifex aeolicus (strain VF5)
Q8CMQ2 2.51e-34 123 34 4 185 3 ahpC Alkyl hydroperoxide reductase C Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
P9WQB7 3.18e-34 123 41 3 151 1 ahpC Alkyl hydroperoxide reductase C Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQB6 3.18e-34 123 41 3 151 3 ahpC Alkyl hydroperoxide reductase C Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q6L140 3.18e-34 123 34 2 194 3 PTO0727 Peroxiredoxin 2 Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828 / KAW 2/3)
Q5HRY1 3.82e-34 122 34 4 185 3 ahpC Alkyl hydroperoxide reductase C Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P0A0B6 6.98e-34 122 35 4 185 3 ahpC Alkyl hydroperoxide reductase C Staphylococcus aureus (strain MW2)
Q6GC91 6.98e-34 122 35 4 185 3 ahpC Alkyl hydroperoxide reductase C Staphylococcus aureus (strain MSSA476)
Q6GJR7 6.98e-34 122 35 4 185 3 ahpC Alkyl hydroperoxide reductase C Staphylococcus aureus (strain MRSA252)
P99074 6.98e-34 122 35 4 185 1 ahpC Alkyl hydroperoxide reductase C Staphylococcus aureus (strain N315)
P0A0B5 6.98e-34 122 35 4 185 3 ahpC Alkyl hydroperoxide reductase C Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HIR5 6.98e-34 122 35 4 185 3 ahpC Alkyl hydroperoxide reductase C Staphylococcus aureus (strain COL)
Q2YVK2 6.98e-34 122 35 4 185 3 ahpC Alkyl hydroperoxide reductase C Staphylococcus aureus (strain bovine RF122 / ET3-1)
P0A0B7 6.98e-34 122 35 4 185 1 ahpC Alkyl hydroperoxide reductase C Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FJN4 6.98e-34 122 35 4 185 3 ahpC Alkyl hydroperoxide reductase C Staphylococcus aureus (strain USA300)
P0AE11 5.13e-33 119 33 4 186 3 ahpC Alkyl hydroperoxide reductase C Shigella flexneri
P0AE08 5.13e-33 119 33 4 186 1 ahpC Alkyl hydroperoxide reductase C Escherichia coli (strain K12)
P0AE09 5.13e-33 119 33 4 186 3 ahpC Alkyl hydroperoxide reductase C Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AE10 5.13e-33 119 33 4 186 3 ahpC Alkyl hydroperoxide reductase C Escherichia coli O157:H7
Q8SS85 6.34e-33 119 36 2 157 1 ECU03_1190 Putative thioredoxin peroxidase Encephalitozoon cuniculi (strain GB-M1)
P0A251 7.09e-33 119 33 4 186 1 ahpC Alkyl hydroperoxide reductase C Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A252 7.09e-33 119 33 4 186 3 ahpC Alkyl hydroperoxide reductase C Salmonella typhi
P49537 8.35e-33 119 29 3 192 3 ycf42 Putative peroxiredoxin ycf42 Trieres chinensis
P26830 4.81e-32 116 34 2 158 3 None Alkyl hydroperoxide reductase C (Fragment) Ferdinandcohnia aciditolerans (strain JCM 32973 / CCTCC AB 2017280 / YN-1)
A2BJD9 1.67e-31 117 37 2 150 3 Hbut_0228 Peroxiredoxin Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5)
A5IIX7 3.04e-30 113 34 3 178 3 Tpet_0121 Peroxiredoxin Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
Q9WZR4 8.78e-30 112 33 3 178 3 TM_0807 Peroxiredoxin Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
A8A9P0 1.53e-29 112 34 3 174 3 Igni_0459 Peroxiredoxin Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125)
A3DKL1 2.53e-29 111 34 2 154 3 Smar_0058 Peroxiredoxin Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1)
Q8R844 3.52e-29 110 33 3 182 3 TTE2186 Peroxiredoxin 2 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q8PYP6 2.37e-28 108 31 5 206 3 MM_0814 Peroxiredoxin Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
P95895 4.64e-28 107 31 4 194 3 SSO2121 Peroxiredoxin Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Q96XS5 1.46e-27 106 34 3 169 3 STK_24420 Peroxiredoxin 2 Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
Q9Y9L0 1.69e-27 107 34 3 163 1 APE_2278 Peroxiredoxin Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)
O29969 3.35e-27 105 35 2 154 3 AF_0270 Peroxiredoxin Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q9HKX0 4.73e-26 103 30 4 194 3 Ta0473 Peroxiredoxin 1 Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165)
Q58146 7.47e-26 102 31 3 176 3 MJ0736 Peroxiredoxin Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q55060 1.45e-25 101 32 1 157 3 None Peroxiredoxin 1 Sulfuracidifex metallicus
Q9UZV4 2.3e-25 100 30 2 175 3 PYRAB10420 Peroxiredoxin Pyrococcus abyssi (strain GE5 / Orsay)
Q8RCY5 1.56e-24 99 35 2 149 3 TTE0270 Peroxiredoxin 1 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q974S8 2.85e-24 98 33 1 154 3 STK_05840 Peroxiredoxin 1 Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
O33665 8.41e-24 96 30 3 178 3 None Peroxiredoxin 2 Sulfuracidifex metallicus
O58966 1.39e-23 96 30 2 175 1 ahpC Peroxiredoxin Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q74NC6 1.6e-23 96 29 3 176 3 NEQ191 Peroxiredoxin Nanoarchaeum equitans (strain Kin4-M)
Q8U218 2.19e-23 95 29 2 175 3 PF1033 Peroxiredoxin Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q6L240 1.13e-22 94 29 3 180 3 PTO0377 Peroxiredoxin 1 Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828 / KAW 2/3)
A6UPH7 3.5e-22 92 30 4 176 3 Mevan_0492 Peroxiredoxin Methanococcus vannielii (strain ATCC 35089 / DSM 1224 / JCM 13029 / OCM 148 / SB)
Q5JF30 3.57e-22 92 30 2 175 1 TK0537 Peroxiredoxin Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q6LY19 6.59e-22 92 30 5 178 3 MMP1174 Peroxiredoxin Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
A4FWZ9 3.38e-21 90 33 3 143 3 MmarC5_0413 Peroxiredoxin Methanococcus maripaludis (strain C5 / ATCC BAA-1333)
Q57109 6.18e-21 89 31 3 154 3 MTBMA_c06100 Peroxiredoxin Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg)
O26262 6.24e-21 89 30 4 180 3 MTH_159 Peroxiredoxin Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q73RS4 3.52e-20 87 34 3 150 3 TDE_0011 Peroxiredoxin Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q8KBN8 1.45e-19 85 34 4 155 3 CT1747 Peroxiredoxin Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q54SE2 2.82e-19 85 27 3 176 3 DDB_G0282517 1-Cys peroxiredoxin Dictyostelium discoideum
P34227 3.31e-19 85 27 3 185 1 PRX1 Peroxiredoxin PRX1, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P0C5C9 6.75e-18 81 33 4 161 2 Os07g0638300 1-Cys peroxiredoxin A Oryza sativa subsp. japonica
P52572 9.27e-18 80 33 3 148 2 PER1 1-Cys peroxiredoxin PER1 Hordeum vulgare
P0C5C8 9.93e-18 80 33 4 161 2 OsI_27030 1-Cys peroxiredoxin A Oryza sativa subsp. indica
A2SZW8 1.5e-17 80 32 5 171 2 PER1 1-Cys peroxiredoxin PER1 Zea mays
P52571 1.81e-17 80 33 3 148 2 None Probable 1-Cys peroxiredoxin (Fragment) Bromus secalinus
Q6W8Q2 3.67e-17 79 33 3 148 2 PER1 1-Cys peroxiredoxin PER1 Triticum aestivum
P52570 5.77e-17 79 29 3 158 2 TSA 1-Cys peroxiredoxin Onchocerca volvulus
Q9LU86 1.29e-16 77 33 5 156 1 PRXQ Peroxiredoxin Q, chloroplastic Arabidopsis thaliana
O35244 1.33e-16 78 28 4 190 1 Prdx6 Peroxiredoxin-6 Rattus norvegicus
P52574 1.84e-16 77 27 2 177 2 None Probable 1-Cys peroxiredoxin Syntrichia ruralis
Q6E2Z6 2.78e-16 77 30 4 165 2 None 1-Cys peroxiredoxin Medicago truncatula
Q6UBI3 2.88e-16 77 31 3 138 2 PRXQ Peroxiredoxin Q, chloroplastic Suaeda salsa
Q9MB35 3.69e-16 76 31 2 132 1 PRXQ Peroxiredoxin Q, chloroplastic (Fragment) Sedum lineare
O04005 9.04e-16 75 29 4 177 2 PER1 1-Cys peroxiredoxin PER1 Arabidopsis thaliana
O17433 7.44e-15 73 29 4 161 1 None 1-Cys peroxiredoxin Dirofilaria immitis
O08709 7.8e-15 73 27 3 190 1 Prdx6 Peroxiredoxin-6 Mus musculus
P0C5D5 8.22e-15 73 27 3 155 2 Os06g0196300 Peroxiredoxin Q, chloroplastic Oryza sativa subsp. japonica
P0C5D4 8.22e-15 73 27 3 155 3 OsI_22010 Putative peroxiredoxin Q, chloroplastic Oryza sativa subsp. indica
Q6QPJ6 1.37e-14 72 29 3 160 1 PRXQ Peroxiredoxin Q, chloroplastic Populus jackii
O77834 3.87e-14 71 27 4 190 1 PRDX6 Peroxiredoxin-6 Bos taurus
Q75SY5 6.3e-14 70 28 3 156 2 AFP1 Peroxiredoxin Q, chloroplastic Gentiana triflora
Q5S1S6 7.5e-14 70 27 3 155 2 PRX1 Peroxiredoxin Q, chloroplastic Triticum aestivum
Q5ZJF4 7.85e-14 70 27 4 190 2 PRDX6 Peroxiredoxin-6 Gallus gallus
Q2PFL9 3.64e-13 68 27 4 190 2 PRDX6 Peroxiredoxin-6 Macaca fascicularis
Q9TSX9 4.55e-13 68 27 4 190 2 PRDX6 Peroxiredoxin-6 Sus scrofa
P0C5D0 1.88e-12 66 32 5 162 3 OsI_026085 1-Cys peroxiredoxin B Oryza sativa subsp. indica
P0C5D1 6.9e-12 65 32 5 161 1 Os07g0638400 1-Cys peroxiredoxin B Oryza sativa subsp. japonica
P30041 7.74e-12 65 27 4 190 1 PRDX6 Peroxiredoxin-6 Homo sapiens
Q5R7E0 2.65e-11 63 26 4 190 2 PRDX6 Peroxiredoxin-6 Pongo abelii
P9WIE3 6.65e-11 61 29 5 140 1 ahpE Alkyl hydroperoxide reductase E Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WIE2 6.65e-11 61 29 5 140 3 ahpE Alkyl hydroperoxide reductase E Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P65689 6.65e-11 61 29 5 140 3 ahpE Alkyl hydroperoxide reductase E Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P72314 6.89e-08 51 52 0 40 3 ahpC Alkyl hydroperoxide reductase C (Fragment) Rhodospirillum rubrum
Q83CY8 1.96e-07 52 26 4 140 1 bcp Putative peroxiredoxin bcp Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Q81SZ9 1.14e-05 47 26 6 141 1 resA Thiol-disulfide oxidoreductase ResA Bacillus anthracis
A0RBT0 1.14e-05 47 26 6 141 3 resA Thiol-disulfide oxidoreductase ResA Bacillus thuringiensis (strain Al Hakam)
P9WIE1 1.46e-05 46 27 6 137 1 bcp Putative peroxiredoxin Rv2521 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WIE0 1.46e-05 46 27 6 137 3 bcp Putative peroxiredoxin MT2597 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q81FU5 1.53e-05 47 26 6 141 3 resA Thiol-disulfide oxidoreductase ResA Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q6HL81 4.9e-05 45 24 5 138 3 resA Thiol-disulfide oxidoreductase ResA Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q73B22 5.09e-05 45 24 5 138 3 resA Thiol-disulfide oxidoreductase ResA Bacillus cereus (strain ATCC 10987 / NRS 248)
Q796Y8 9.5e-05 44 23 4 140 3 ygaF Peroxiredoxin Bcp Bacillus subtilis (strain 168)
P0AE55 0.00045 42 24 4 127 3 bcp Putative peroxiredoxin bcp Shigella flexneri
P0AE52 0.00045 42 24 4 127 1 bcp Peroxiredoxin Bcp Escherichia coli (strain K12)
P0AE53 0.00045 42 24 4 127 3 bcp Putative peroxiredoxin bcp Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AE54 0.00045 42 24 4 127 3 bcp Putative peroxiredoxin bcp Escherichia coli O157:H7
Q8P9V9 0.000519 42 31 3 90 1 bcp Peroxiredoxin Bcp Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
P55979 0.000563 42 28 6 148 3 bcp Putative peroxiredoxin bcp Helicobacter pylori (strain ATCC 700392 / 26695)
Q9ZMU4 0.000785 42 27 6 148 3 bcp Putative peroxiredoxin bcp Helicobacter pylori (strain J99 / ATCC 700824)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS16595
Feature type CDS
Gene -
Product peroxiredoxin C
Location 138593 - 139195 (strand: 1)
Length 603 (nucleotides) / 200 (amino acids)

Contig

Accession term accessions NZ_VXKB01000006 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 212134 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2264
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00578 AhpC/TSA family
PF10417 C-terminal domain of 1-Cys peroxiredoxin

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0450 Defense mechanisms (V) V Alkyl hydroperoxide reductase subunit AhpC (peroxiredoxin)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03386 peroxiredoxin 2/4 [EC:1.11.1.24] Apoptosis - fly -

Protein Sequence

MVLVTRQAPDFTAAAVLGNGEIVDNFNLKKHLNGRPAVIFFWPMDFTFVCPSELIAFDHRYEEFKKRGVEVVGISMDSEFVHNAWRNTAIDAGGIGQVQYPMVADIKHDIMKAYGVEHPEAGVALRGSFLVDKNGVVRHQVINDLPLGRNVDEMIRMVDALQFHEEHGEVCPAQWEKGQEGMSASPKGVADYLKKNSGKL

Flanking regions ( +/- flanking 50bp)

TTCTATCTGCTGTTTTTTGCCATACTCTATTAATCTTACAGGAGTAAATTATGGTTCTGGTAACCCGTCAAGCCCCCGATTTTACAGCTGCAGCCGTTCTTGGTAACGGTGAGATTGTTGATAATTTTAATCTGAAAAAACACCTGAACGGCCGCCCGGCTGTTATCTTTTTCTGGCCAATGGACTTCACCTTCGTTTGTCCTTCAGAGCTGATCGCATTTGATCACCGCTATGAAGAGTTCAAAAAACGTGGTGTGGAAGTGGTCGGCATATCTATGGACTCAGAGTTTGTTCATAACGCATGGCGTAACACCGCTATCGATGCGGGTGGTATCGGTCAGGTTCAGTACCCGATGGTTGCAGATATCAAACACGACATCATGAAAGCTTACGGTGTTGAACATCCTGAAGCGGGTGTTGCACTGCGCGGCTCTTTCCTGGTCGACAAAAATGGTGTTGTCCGCCACCAGGTTATCAATGACCTGCCGCTGGGCCGTAACGTTGATGAAATGATCCGTATGGTCGATGCGCTGCAGTTCCACGAAGAGCATGGCGAAGTGTGCCCTGCACAGTGGGAAAAAGGTCAGGAAGGTATGAGCGCGTCTCCGAAAGGCGTTGCTGACTACCTGAAAAAGAACTCCGGCAAGCTGTAATTTCCGGCAGTTAAAAGATACAAAAAACCAGCCTCAGGGCTGGTTTTTTT