Homologs in group_913

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_04930 FBDBKF_04930 95.5 Morganella morganii S1 folD bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD
EHELCC_06220 EHELCC_06220 95.5 Morganella morganii S2 folD bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD
NLDBIP_06540 NLDBIP_06540 95.5 Morganella morganii S4 folD bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD
LHKJJB_03420 LHKJJB_03420 95.5 Morganella morganii S3 folD bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD
HKOGLL_06895 HKOGLL_06895 95.5 Morganella morganii S5 folD bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD
PMI_RS10620 PMI_RS10620 87.8 Proteus mirabilis HI4320 folD bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD

Distribution of the homologs in the orthogroup group_913

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_913

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7MZH1 0.0 524 87 0 284 3 folD Bifunctional protein FolD Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B4F1G5 0.0 521 88 0 286 3 folD Bifunctional protein FolD Proteus mirabilis (strain HI4320)
A6T5R4 0.0 514 85 0 287 3 folD Bifunctional protein FolD Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5Y0K4 0.0 514 85 0 287 3 folD Bifunctional protein FolD Klebsiella pneumoniae (strain 342)
A1JNX2 0.0 510 85 0 287 3 folD Bifunctional protein FolD Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A8GAY2 0.0 509 85 0 284 3 folD Bifunctional protein FolD Serratia proteamaculans (strain 568)
B6I0H4 0.0 508 84 1 288 3 folD Bifunctional protein FolD Escherichia coli (strain SE11)
P24186 0.0 508 84 1 288 1 folD Bifunctional protein FolD Escherichia coli (strain K12)
B1IZ72 0.0 508 84 1 288 3 folD Bifunctional protein FolD Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
B1XGC7 0.0 508 84 1 288 3 folD Bifunctional protein FolD Escherichia coli (strain K12 / DH10B)
C4ZUX7 0.0 508 84 1 288 3 folD Bifunctional protein FolD Escherichia coli (strain K12 / MC4100 / BW2952)
B7M4N2 0.0 508 84 1 288 3 folD Bifunctional protein FolD Escherichia coli O8 (strain IAI1)
B7L7F6 0.0 508 84 1 288 3 folD Bifunctional protein FolD Escherichia coli (strain 55989 / EAEC)
A7ZIT8 0.0 508 84 1 288 3 folD Bifunctional protein FolD Escherichia coli O139:H28 (strain E24377A / ETEC)
Q3Z4P8 0.0 507 85 0 284 3 folD Bifunctional protein FolD Shigella sonnei (strain Ss046)
Q83SC8 0.0 507 85 0 284 3 folD Bifunctional protein FolD Shigella flexneri
Q0T773 0.0 507 85 0 284 3 folD Bifunctional protein FolD Shigella flexneri serotype 5b (strain 8401)
Q324Y6 0.0 507 85 0 284 3 folD Bifunctional protein FolD Shigella boydii serotype 4 (strain Sb227)
B2TTB0 0.0 507 85 0 284 3 folD Bifunctional protein FolD Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q1RF04 0.0 507 85 0 284 3 folD Bifunctional protein FolD Escherichia coli (strain UTI89 / UPEC)
Q8FK41 0.0 507 85 0 284 3 folD Bifunctional protein FolD Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TKB2 0.0 507 85 0 284 3 folD Bifunctional protein FolD Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1A8J4 0.0 507 85 0 284 3 folD Bifunctional protein FolD Escherichia coli O1:K1 / APEC
A7ZXI3 0.0 507 85 0 284 3 folD Bifunctional protein FolD Escherichia coli O9:H4 (strain HS)
B7MRJ2 0.0 507 85 0 284 3 folD Bifunctional protein FolD Escherichia coli O81 (strain ED1a)
B5YPP4 0.0 507 85 0 284 3 folD Bifunctional protein FolD Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XCT6 0.0 507 85 0 284 3 folD Bifunctional protein FolD Escherichia coli O157:H7
B7ME52 0.0 507 85 0 284 3 folD Bifunctional protein FolD Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UKK6 0.0 507 85 0 284 3 folD Bifunctional protein FolD Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B7LJI7 0.0 507 84 1 288 3 folD Bifunctional protein FolD Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B1LKE8 0.0 507 85 0 284 3 folD Bifunctional protein FolD Escherichia coli (strain SMS-3-5 / SECEC)
B7N983 0.0 507 85 0 284 3 folD Bifunctional protein FolD Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B7NL23 0.0 507 85 0 284 3 folD Bifunctional protein FolD Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B1JHI9 0.0 506 85 0 284 3 folD Bifunctional protein FolD Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66DK7 0.0 506 85 0 284 3 folD Bifunctional protein FolD Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TP60 0.0 506 85 0 284 3 folD Bifunctional protein FolD Yersinia pestis (strain Pestoides F)
Q1CKX8 0.0 506 85 0 284 3 folD Bifunctional protein FolD Yersinia pestis bv. Antiqua (strain Nepal516)
A9R256 0.0 506 85 0 284 3 folD Bifunctional protein FolD Yersinia pestis bv. Antiqua (strain Angola)
Q7CJY7 0.0 506 85 0 284 3 folD Bifunctional protein FolD Yersinia pestis
B2K7N4 0.0 506 85 0 284 3 folD Bifunctional protein FolD Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C4U4 0.0 506 85 0 284 3 folD Bifunctional protein FolD Yersinia pestis bv. Antiqua (strain Antiqua)
A7FL44 0.0 506 85 0 284 3 folD Bifunctional protein FolD Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A9MLA4 0.0 506 84 0 284 3 folD Bifunctional protein FolD Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A8AJS4 0.0 506 85 0 284 3 folD Bifunctional protein FolD Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A4W7J0 0.0 506 83 0 287 3 folD Bifunctional protein FolD Enterobacter sp. (strain 638)
A7MJZ6 0.0 505 84 0 287 3 folD Bifunctional protein FolD Cronobacter sakazakii (strain ATCC BAA-894)
Q32JK7 0.0 505 84 1 288 3 folD Bifunctional protein FolD Shigella dysenteriae serotype 1 (strain Sd197)
P58688 0.0 503 84 0 284 3 folD Bifunctional protein FolD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TN64 0.0 503 84 0 284 3 folD Bifunctional protein FolD Salmonella schwarzengrund (strain CVM19633)
B5BCZ5 0.0 503 84 0 284 3 folD Bifunctional protein FolD Salmonella paratyphi A (strain AKU_12601)
C0PVJ3 0.0 503 84 0 284 3 folD Bifunctional protein FolD Salmonella paratyphi C (strain RKS4594)
A9MW26 0.0 503 84 0 284 3 folD Bifunctional protein FolD Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PCE5 0.0 503 84 0 284 3 folD Bifunctional protein FolD Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SXP7 0.0 503 84 0 284 3 folD Bifunctional protein FolD Salmonella newport (strain SL254)
B4TA94 0.0 503 84 0 284 3 folD Bifunctional protein FolD Salmonella heidelberg (strain SL476)
B5R6X5 0.0 503 84 0 284 3 folD Bifunctional protein FolD Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5FLQ2 0.0 503 84 0 284 3 folD Bifunctional protein FolD Salmonella dublin (strain CT_02021853)
Q57S24 0.0 503 84 0 284 3 folD Bifunctional protein FolD Salmonella choleraesuis (strain SC-B67)
B5EYE2 0.0 503 84 0 284 3 folD Bifunctional protein FolD Salmonella agona (strain SL483)
B5QUV5 0.0 503 84 0 284 3 folD Bifunctional protein FolD Salmonella enteritidis PT4 (strain P125109)
Q60006 2.41e-180 501 84 0 284 3 folD Bifunctional protein FolD Salmonella typhi
C6DAX0 2.71e-180 500 83 0 287 3 folD Bifunctional protein FolD Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6D2E6 2.11e-179 498 82 0 287 3 folD Bifunctional protein FolD Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
B2VBD1 8.13e-175 487 83 0 280 3 folD Bifunctional protein FolD Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
C5B8V3 1.67e-172 481 78 0 284 3 folD Bifunctional protein FolD Edwardsiella ictaluri (strain 93-146)
Q2NV44 3.15e-172 480 78 0 284 3 folD Bifunctional protein FolD Sodalis glossinidius (strain morsitans)
A7MT09 1.26e-155 438 72 0 285 3 folD Bifunctional protein FolD Vibrio campbellii (strain ATCC BAA-1116)
B5FG69 1.45e-155 438 70 0 285 3 folD Bifunctional protein FolD Aliivibrio fischeri (strain MJ11)
Q5E3Y1 1.45e-155 438 70 0 285 3 folD Bifunctional protein FolD Aliivibrio fischeri (strain ATCC 700601 / ES114)
A4SNM0 3.96e-155 437 71 0 285 3 folD Bifunctional protein FolD Aeromonas salmonicida (strain A449)
A0KJD4 2.72e-154 435 71 0 287 3 folD Bifunctional protein FolD Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
C4K7E4 5.18e-153 431 73 0 281 3 folD Bifunctional protein FolD Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
B0TLV1 5.92e-153 431 71 0 284 3 folD Bifunctional protein FolD Shewanella halifaxensis (strain HAW-EB4)
Q1LTX1 1.49e-152 430 71 0 280 3 folD Bifunctional protein FolD Baumannia cicadellinicola subsp. Homalodisca coagulata
B8CRF9 4.52e-152 429 70 0 286 3 folD Bifunctional protein FolD Shewanella piezotolerans (strain WP3 / JCM 13877)
Q9KQQ6 1.07e-151 428 70 0 285 3 folD Bifunctional protein FolD Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F6V4 1.07e-151 428 70 0 285 3 folD Bifunctional protein FolD Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
B7VL71 1.11e-151 428 70 0 285 3 folD Bifunctional protein FolD Vibrio atlanticus (strain LGP32)
P51696 2.13e-151 427 71 0 283 1 folD Bifunctional protein FolD Photobacterium phosphoreum
Q0HTK5 3.84e-151 427 70 0 284 3 folD Bifunctional protein FolD Shewanella sp. (strain MR-7)
Q8EG21 5.52e-151 426 70 0 284 3 folD Bifunctional protein FolD Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q0HH99 6.09e-151 426 70 0 284 3 folD Bifunctional protein FolD Shewanella sp. (strain MR-4)
A0KYM1 6.09e-151 426 70 0 284 3 folD Bifunctional protein FolD Shewanella sp. (strain ANA-3)
Q7MIX2 4.02e-150 424 72 0 285 3 folD Bifunctional protein FolD Vibrio vulnificus (strain YJ016)
Q8DB06 4.02e-150 424 72 0 285 3 folD Bifunctional protein FolD Vibrio vulnificus (strain CMCP6)
A8H616 4.19e-150 424 71 0 284 3 folD Bifunctional protein FolD Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
A1RL91 4.67e-150 424 70 0 284 3 folD Bifunctional protein FolD Shewanella sp. (strain W3-18-1)
A8FTH7 5.51e-150 424 71 0 284 3 folD Bifunctional protein FolD Shewanella sediminis (strain HAW-EB3)
C4LG01 7.99e-150 423 70 0 284 3 folD Bifunctional protein FolD Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q3IF52 1.1e-149 423 69 0 283 3 folD Bifunctional protein FolD Pseudoalteromonas translucida (strain TAC 125)
A4Y5I0 1.28e-149 423 70 0 284 3 folD Bifunctional protein FolD Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q6LNV7 1.69e-149 422 70 0 283 3 folD Bifunctional protein FolD Photobacterium profundum (strain SS9)
B6EIM4 2.01e-149 422 70 0 285 3 folD Bifunctional protein FolD Aliivibrio salmonicida (strain LFI1238)
A6WLP9 4.98e-149 421 70 0 284 3 folD Bifunctional protein FolD Shewanella baltica (strain OS185)
A3D303 4.98e-149 421 70 0 284 3 folD Bifunctional protein FolD Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8E5F1 4.98e-149 421 70 0 284 3 folD Bifunctional protein FolD Shewanella baltica (strain OS223)
Q07ZX6 5.37e-149 421 71 0 283 3 folD Bifunctional protein FolD Shewanella frigidimarina (strain NCIMB 400)
A9KWH5 8.51e-149 421 70 0 284 3 folD Bifunctional protein FolD Shewanella baltica (strain OS195)
Q87RB8 1.58e-148 420 72 0 283 3 folD Bifunctional protein FolD Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B1KLT9 2.42e-148 420 69 0 285 3 folD Bifunctional protein FolD Shewanella woodyi (strain ATCC 51908 / MS32)
A3QFX8 2.46e-148 419 71 0 284 3 folD Bifunctional protein FolD Shewanella loihica (strain ATCC BAA-1088 / PV-4)
A1S4X3 3.02e-147 417 70 0 284 3 folD Bifunctional protein FolD Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q5QWH6 2.16e-146 415 69 0 284 3 folD Bifunctional protein FolD Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q12L99 4.96e-146 414 71 0 284 3 folD Bifunctional protein FolD Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
C1DHE7 2.41e-144 409 68 0 283 3 folD Bifunctional protein FolD Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
B4RV70 3.98e-144 409 67 0 283 3 folD Bifunctional protein FolD Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
A4XTZ3 1.02e-142 405 68 0 283 3 folD1 Bifunctional protein FolD 1 Pseudomonas mendocina (strain ymp)
Q493A0 4.79e-142 404 66 0 283 3 folD Bifunctional protein FolD Blochmanniella pennsylvanica (strain BPEN)
Q4ZVN1 7.89e-142 403 66 0 284 3 folD1 Bifunctional protein FolD 1 Pseudomonas syringae pv. syringae (strain B728a)
Q48KZ8 8.9e-142 403 66 0 284 3 folD1 Bifunctional protein FolD 1 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q9I2U6 1.33e-141 402 66 0 284 1 folD Bifunctional protein FolD Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02KT7 1.33e-141 402 66 0 284 3 folD Bifunctional protein FolD Pseudomonas aeruginosa (strain UCBPP-PA14)
B7VB83 1.33e-141 402 66 0 284 3 folD Bifunctional protein FolD Pseudomonas aeruginosa (strain LESB58)
Q87YR0 1.75e-141 402 66 0 284 3 folD1 Bifunctional protein FolD 1 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
A6V726 4.91e-141 401 66 0 284 3 folD Bifunctional protein FolD Pseudomonas aeruginosa (strain PA7)
A4VL74 1.26e-140 400 67 0 284 3 folD Bifunctional protein FolD Stutzerimonas stutzeri (strain A1501)
Q9CJR1 1.37e-140 400 68 1 280 3 folD Bifunctional protein FolD Pasteurella multocida (strain Pm70)
Q47XL6 2.43e-140 399 68 0 281 3 folD2 Bifunctional protein FolD 2 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q65RF1 1.46e-139 397 68 0 280 3 folD Bifunctional protein FolD Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q15R43 1.84e-139 397 67 0 283 3 folD Bifunctional protein FolD Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q3K9W7 6.84e-139 395 65 0 283 3 folD Bifunctional protein FolD Pseudomonas fluorescens (strain Pf0-1)
B1J675 1.07e-137 392 66 0 283 3 folD Bifunctional protein FolD Pseudomonas putida (strain W619)
A5W638 1.2e-137 392 66 0 283 3 folD Bifunctional protein FolD Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q88KM5 1.2e-137 392 66 0 283 3 folD2 Bifunctional protein FolD 2 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KJG3 1.59e-137 392 66 0 283 3 folD1 Bifunctional protein FolD 1 Pseudomonas putida (strain GB-1)
Q1ICB3 3.52e-137 391 66 0 283 3 folD Bifunctional protein FolD Pseudomonas entomophila (strain L48)
Q7VRB3 1.66e-136 390 66 0 278 3 folD Bifunctional protein FolD Blochmanniella floridana
Q4K9J4 3.14e-136 389 64 0 283 3 folD Bifunctional protein FolD Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q0I3S5 8.75e-136 388 66 1 280 3 folD Bifunctional protein FolD Histophilus somni (strain 129Pt)
B0USU2 9.15e-136 387 66 1 280 3 folD Bifunctional protein FolD Histophilus somni (strain 2336)
A1SUX5 1.51e-135 387 68 0 285 3 folD Bifunctional protein FolD Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
A6VMD8 8.22e-135 385 64 0 284 3 folD Bifunctional protein FolD Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
P44313 4.86e-134 383 65 2 285 3 folD Bifunctional protein FolD Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UAS4 4.86e-134 383 65 2 285 3 folD Bifunctional protein FolD Haemophilus influenzae (strain PittEE)
Q4QMI7 4.86e-134 383 65 2 285 3 folD Bifunctional protein FolD Haemophilus influenzae (strain 86-028NP)
B8F605 1.18e-133 382 65 1 280 3 folD Bifunctional protein FolD Glaesserella parasuis serovar 5 (strain SH0165)
Q8K979 1.4e-133 382 62 0 284 3 folD Bifunctional protein FolD Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
A5UHL4 3.66e-132 379 64 2 285 3 folD Bifunctional protein FolD Haemophilus influenzae (strain PittGG)
A1U1Q5 2.86e-131 376 63 0 283 3 folD Bifunctional protein FolD Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q1QVV9 5.84e-131 375 63 1 284 3 folD Bifunctional protein FolD Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
B0BPI2 6.7e-131 375 63 1 280 3 folD Bifunctional protein FolD Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GXP3 6.7e-131 375 63 1 280 3 folD Bifunctional protein FolD Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N0Q7 1.34e-130 375 62 1 280 3 folD Bifunctional protein FolD Actinobacillus pleuropneumoniae serotype 5b (strain L20)
P57557 3.99e-130 374 65 0 284 3 folD Bifunctional protein FolD Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q2SK39 5.52e-128 369 64 0 281 3 folD Bifunctional protein FolD Hahella chejuensis (strain KCTC 2396)
Q8D2W0 1.24e-127 367 61 0 277 3 folD Bifunctional protein FolD Wigglesworthia glossinidia brevipalpis
Q3SKX9 1.8e-127 367 65 0 279 3 folD Bifunctional protein FolD Thiobacillus denitrificans (strain ATCC 25259)
B8GNT6 2.62e-127 366 64 0 281 3 folD Bifunctional protein FolD Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q89A92 2.04e-125 362 59 0 281 3 folD Bifunctional protein FolD Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q31FY5 2.04e-125 362 61 1 280 3 folD2 Bifunctional protein FolD 2 Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q7NWQ6 2.28e-124 359 62 0 279 3 folD Bifunctional protein FolD Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
B6J1Z2 5.89e-124 358 61 0 282 3 folD Bifunctional protein FolD Coxiella burnetii (strain CbuG_Q212)
Q83EK7 2.24e-123 356 61 0 282 3 folD Bifunctional protein FolD Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NB47 2.24e-123 356 61 0 282 3 folD Bifunctional protein FolD Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KGQ5 2.24e-123 356 61 0 282 3 folD Bifunctional protein FolD Coxiella burnetii (strain Dugway 5J108-111)
B6J5U6 4.46e-123 355 60 0 282 3 folD Bifunctional protein FolD Coxiella burnetii (strain CbuK_Q154)
Q7VM86 6.58e-123 355 61 1 282 3 folD Bifunctional protein FolD Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q1GXE6 8.49e-123 355 62 0 280 3 folD Bifunctional protein FolD Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q3J8Z0 3.53e-122 353 63 0 284 3 folD Bifunctional protein FolD Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q0AB42 4.17e-122 353 60 0 280 3 folD Bifunctional protein FolD Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
A1WUN4 5.75e-120 348 60 1 287 3 folD Bifunctional protein FolD Halorhodospira halophila (strain DSM 244 / SL1)
C1D5X9 8.9e-120 347 60 0 279 3 folD Bifunctional protein FolD Laribacter hongkongensis (strain HLHK9)
B5EJA0 7.79e-117 340 61 0 281 3 folD Bifunctional protein FolD Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7JBX9 7.79e-117 340 61 0 281 3 folD Bifunctional protein FolD Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
Q3BSP5 3.13e-115 336 59 1 286 3 folD Bifunctional protein FolD Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q5H0S4 4.68e-115 336 60 1 279 3 folD Bifunctional protein FolD Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SLG3 4.68e-115 336 60 1 279 3 folD Bifunctional protein FolD Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2P3R1 4.68e-115 336 60 1 279 3 folD Bifunctional protein FolD Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q31HQ4 1.75e-114 334 59 0 279 3 folD1 Bifunctional protein FolD 1 Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
A1KWF4 3.26e-114 333 57 1 284 3 folD Bifunctional protein FolD Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q5WX38 3.26e-114 333 54 0 284 3 folD Bifunctional protein FolD Legionella pneumophila (strain Lens)
A5IBF0 3.26e-114 333 54 0 284 3 folD Bifunctional protein FolD Legionella pneumophila (strain Corby)
Q8PK86 3.57e-114 333 59 1 286 3 folD Bifunctional protein FolD Xanthomonas axonopodis pv. citri (strain 306)
Q9JWI9 6.72e-114 332 57 1 284 3 folD Bifunctional protein FolD Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9M068 7.17e-114 332 57 1 284 3 folD Bifunctional protein FolD Neisseria meningitidis serogroup C (strain 053442)
P0C277 1.22e-113 332 57 1 284 3 folD Bifunctional protein FolD Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q8P8Q4 1.51e-113 332 60 1 276 3 folD Bifunctional protein FolD Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RSB3 1.51e-113 332 60 1 276 3 folD Bifunctional protein FolD Xanthomonas campestris pv. campestris (strain B100)
Q4UVC7 1.51e-113 332 60 1 276 3 folD Bifunctional protein FolD Xanthomonas campestris pv. campestris (strain 8004)
Q9PAR4 2.24e-113 331 59 1 280 3 folD Bifunctional protein FolD Xylella fastidiosa (strain 9a5c)
Q87BK4 2.46e-113 331 59 1 280 3 folD Bifunctional protein FolD Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q5ZVZ1 7.68e-113 330 54 0 284 3 folD Bifunctional protein FolD Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q5X5Q9 3.04e-112 328 54 0 284 3 folD Bifunctional protein FolD Legionella pneumophila (strain Paris)
B4RQN5 5.25e-112 327 56 1 284 3 folD Bifunctional protein FolD Neisseria gonorrhoeae (strain NCCP11945)
Q5F5D0 5.25e-112 327 56 1 284 3 folD Bifunctional protein FolD Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q057D7 6.08e-104 307 53 1 282 3 folD Bifunctional protein FolD Buchnera aphidicola subsp. Cinara cedri (strain Cc)
A0LE04 8.63e-103 304 51 0 282 3 folD Bifunctional protein FolD Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
A5GAM5 2.02e-101 300 54 1 278 3 folD Bifunctional protein FolD Geotalea uraniireducens (strain Rf4)
B9M769 2.11e-100 298 52 1 278 3 folD Bifunctional protein FolD Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
Q2L1G0 4.06e-100 297 55 1 280 3 folD Bifunctional protein FolD Bordetella avium (strain 197N)
A1AXA0 7.7e-100 296 54 1 276 3 folD Bifunctional protein FolD Ruthia magnifica subsp. Calyptogena magnifica
Q2RIB4 8.06e-99 294 55 1 278 3 folD Bifunctional protein FolD Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q7M8X1 1.15e-98 294 51 0 277 3 folD Bifunctional protein FolD Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
B2V9R3 2.09e-98 293 53 3 275 3 folD Bifunctional protein FolD Sulfurihydrogenibium sp. (strain YO3AOP1)
Q39WH4 8.62e-98 291 53 1 279 3 folD2 Bifunctional protein FolD 2 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q7WJG1 2.18e-97 290 54 1 280 3 folD Bifunctional protein FolD Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q7VZC8 2.18e-97 290 54 1 280 3 folD1 Bifunctional protein FolD 1 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7WAC0 2.18e-97 290 54 1 280 3 folD1 Bifunctional protein FolD 1 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q472L4 1.04e-96 288 53 1 280 3 folD Bifunctional protein FolD Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
A5CVZ6 1.86e-96 288 54 1 276 3 folD Bifunctional protein FolD Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
A9ISZ5 1.91e-96 288 55 1 278 3 folD Bifunctional protein FolD Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
A0Q505 2.25e-96 288 51 2 280 3 folD Bifunctional protein FolD Francisella tularensis subsp. novicida (strain U112)
A4IYR4 2.73e-96 288 51 2 280 3 folD Bifunctional protein FolD Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NGF3 2.73e-96 288 51 2 280 1 folD Bifunctional protein FolD Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q14HV5 2.73e-96 288 51 2 280 3 folD Bifunctional protein FolD Francisella tularensis subsp. tularensis (strain FSC 198)
Q47IX6 1.45e-95 286 51 1 280 3 folD Bifunctional protein FolD Dechloromonas aromatica (strain RCB)
A3DEE6 5.25e-95 284 50 1 280 3 folD Bifunctional protein FolD Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q3M9M0 6.27e-95 285 50 3 288 3 folD Bifunctional protein FolD Trichormus variabilis (strain ATCC 29413 / PCC 7937)
A7GXK2 6.68e-95 284 51 2 280 3 folD Bifunctional protein FolD Campylobacter curvus (strain 525.92)
Q0KBW5 8.39e-95 284 52 1 281 3 folD Bifunctional protein FolD Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q30RJ0 9.89e-95 284 47 0 284 3 folD Bifunctional protein FolD Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
B2SF67 1.11e-94 283 50 2 280 3 folD Bifunctional protein FolD Francisella tularensis subsp. mediasiatica (strain FSC147)
B0U009 1.46e-94 283 50 2 280 3 folD Bifunctional protein FolD Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
B4EDU1 1.5e-94 283 52 1 280 3 folD Bifunctional protein FolD Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
Q8Z086 1.65e-94 283 49 2 288 3 folD Bifunctional protein FolD Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q989A7 2.47e-94 283 52 4 287 3 folD1 Bifunctional protein FolD 1 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
B3R4L6 3.7e-94 282 53 1 280 3 folD Bifunctional protein FolD Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
A9AGS9 1.09e-93 281 52 1 281 3 folD Bifunctional protein FolD Burkholderia multivorans (strain ATCC 17616 / 249)
Q1D7Y2 1.34e-93 281 52 4 284 3 folD2 Bifunctional protein FolD 2 Myxococcus xanthus (strain DK1622)
Q2VYZ7 1.98e-93 281 52 1 289 3 folD Bifunctional protein FolD Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q2G338 2.28e-93 281 52 2 284 3 folD Bifunctional protein FolD Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
B1XUA6 2.33e-93 280 52 1 281 3 folD Bifunctional protein FolD Polynucleobacter necessarius subsp. necessarius (strain STIR1)
Q1BHV3 3.06e-93 280 52 1 280 3 folD Bifunctional protein FolD Burkholderia orbicola (strain AU 1054)
A4JG19 7.33e-93 279 52 1 280 3 folD Bifunctional protein FolD Burkholderia vietnamiensis (strain G4 / LMG 22486)
A6Q815 1.61e-92 278 48 0 278 3 folD Bifunctional protein FolD Sulfurovum sp. (strain NBC37-1)
A4WQ13 2.02e-92 278 54 1 282 3 folD Bifunctional protein FolD Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
A0K8R4 2.06e-92 278 52 1 280 3 folD Bifunctional protein FolD Burkholderia cenocepacia (strain HI2424)
A1AL91 2.33e-92 278 53 1 278 3 folD Bifunctional protein FolD Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
B9L952 3.72e-92 277 47 1 278 3 folD Bifunctional protein FolD Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH)
Q1LP48 3.76e-92 277 53 1 280 3 folD Bifunctional protein FolD Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
A4IQS0 4.15e-92 277 50 1 285 3 folD Bifunctional protein FolD Geobacillus thermodenitrificans (strain NG80-2)
Q7VGF6 4.48e-92 277 48 1 274 3 folD Bifunctional protein FolD Helicobacter hepaticus (strain ATCC 51449 / 3B1)
B8I761 4.94e-92 277 50 1 278 3 folD Bifunctional protein FolD Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
B5YJV1 9.09e-92 276 49 1 280 3 folD Bifunctional protein FolD Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
B7KEP3 9.58e-92 276 46 1 284 3 folD Bifunctional protein FolD Gloeothece citriformis (strain PCC 7424)
O67736 1.25e-91 276 53 2 279 3 folD Bifunctional protein FolD Aquifex aeolicus (strain VF5)
Q74EU7 1.3e-91 276 52 1 278 3 folD2 Bifunctional protein FolD 2 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q8FVP6 1.37e-91 276 51 4 287 3 folD Bifunctional protein FolD Brucella suis biovar 1 (strain 1330)
A9WZ75 1.37e-91 276 51 4 287 3 folD Bifunctional protein FolD Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VV73 1.37e-91 276 51 4 287 3 folD Bifunctional protein FolD Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q8YCL8 1.37e-91 276 51 4 287 3 folD Bifunctional protein FolD Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RLT3 1.37e-91 276 51 4 287 3 folD Bifunctional protein FolD Brucella melitensis biotype 2 (strain ATCC 23457)
A9MC67 1.37e-91 276 51 4 287 3 folD Bifunctional protein FolD Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q578R0 1.37e-91 276 51 4 287 3 folD Bifunctional protein FolD Brucella abortus biovar 1 (strain 9-941)
Q2YL33 1.37e-91 276 51 4 287 3 folD Bifunctional protein FolD Brucella abortus (strain 2308)
B2SAP4 1.37e-91 276 51 4 287 3 folD Bifunctional protein FolD Brucella abortus (strain S19)
B9KLK2 1.8e-91 276 54 5 284 3 folD Bifunctional protein FolD Cereibacter sphaeroides (strain KD131 / KCTC 12085)
A1K589 1.81e-91 276 50 2 284 3 folD Bifunctional protein FolD Azoarcus sp. (strain BH72)
Q5N421 1.81e-91 275 48 0 276 3 folD Bifunctional protein FolD Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q31Q60 1.81e-91 275 48 0 276 3 folD Bifunctional protein FolD Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q88LI7 2.15e-91 275 52 3 285 3 folD1 Bifunctional protein FolD 1 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B1JV19 2.22e-91 275 52 1 280 3 folD Bifunctional protein FolD Burkholderia orbicola (strain MC0-3)
A6Q2W6 2.25e-91 275 48 1 278 3 folD Bifunctional protein FolD Nitratiruptor sp. (strain SB155-2)
A7I254 2.42e-91 275 49 1 277 3 folD Bifunctional protein FolD Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
C6BSL6 2.48e-91 275 50 2 282 3 folD Bifunctional protein FolD Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
A3PM50 2.64e-91 275 54 5 284 3 folD Bifunctional protein FolD Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
B7GHF9 3.11e-91 275 50 3 285 3 folD Bifunctional protein FolD Anoxybacillus flavithermus (strain DSM 21510 / WK1)
B1YT42 3.79e-91 275 52 1 276 3 folD Bifunctional protein FolD Burkholderia ambifaria (strain MC40-6)
Q39ES6 4.61e-91 274 52 1 276 3 folD Bifunctional protein FolD Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
A9GW22 5.2e-91 274 51 1 281 3 folD Bifunctional protein FolD Sorangium cellulosum (strain So ce56)
Q0BDP0 6.12e-91 274 52 1 276 3 folD Bifunctional protein FolD Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
P54382 7.53e-91 274 49 1 280 1 folD Bifunctional protein FolD Bacillus subtilis (strain 168)
Q2YC56 7.86e-91 274 49 1 285 3 folD Bifunctional protein FolD Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q3J049 7.94e-91 274 53 3 283 3 folD Bifunctional protein FolD Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A1VGV4 7.95e-91 274 49 2 279 3 folD Bifunctional protein FolD Nitratidesulfovibrio vulgaris (strain DP4)
Q72F91 7.95e-91 274 49 2 279 3 folD Bifunctional protein FolD Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
A7Z6J9 9.06e-91 273 49 1 279 3 folD Bifunctional protein FolD Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
A6X610 1.16e-90 274 51 4 287 3 folD Bifunctional protein FolD Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q10X46 1.19e-90 273 49 1 276 3 folD Bifunctional protein FolD Trichodesmium erythraeum (strain IMS101)
B2UFY4 1.39e-90 273 53 1 276 3 folD Bifunctional protein FolD Ralstonia pickettii (strain 12J)
A4SWT5 1.48e-90 273 53 1 281 3 folD Bifunctional protein FolD Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
Q73RS2 1.67e-90 273 52 3 288 3 folD Bifunctional protein FolD Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
B8J466 1.78e-90 273 50 2 281 3 folD Bifunctional protein FolD Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
Q55626 2.19e-90 273 46 1 284 3 folD Bifunctional protein FolD Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
C4ZBG7 2.26e-90 272 50 1 276 3 folD Bifunctional protein FolD Agathobacter rectalis (strain ATCC 33656 / DSM 3377 / JCM 17463 / KCTC 5835 / VPI 0990)
Q8E168 2.34e-90 273 49 0 276 3 folD Bifunctional protein FolD Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E6M3 2.34e-90 273 49 0 276 3 folD Bifunctional protein FolD Streptococcus agalactiae serotype III (strain NEM316)
Q3K2M6 2.34e-90 273 49 0 276 3 folD Bifunctional protein FolD Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q5LNV2 2.63e-90 273 52 2 282 3 folD1 Bifunctional protein FolD 1/3 Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q92BZ4 3.99e-90 272 50 1 278 3 folD Bifunctional protein FolD Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
A6UB98 4.58e-90 272 52 3 283 3 folD2 Bifunctional protein FolD 2 Sinorhizobium medicae (strain WSM419)
Q2RWY4 6.71e-90 272 51 2 290 3 folD Bifunctional protein FolD Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
B5XM84 6.73e-90 271 51 0 276 3 folD Bifunctional protein FolD Streptococcus pyogenes serotype M49 (strain NZ131)
P0DF89 6.73e-90 271 51 0 276 3 folD Bifunctional protein FolD Streptococcus pyogenes serotype M3 (strain SSI-1)
A2RDM9 6.73e-90 271 51 0 276 3 folD Bifunctional protein FolD Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J5U5 6.73e-90 271 51 0 276 3 folD Bifunctional protein FolD Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JG29 6.73e-90 271 51 0 276 3 folD Bifunctional protein FolD Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JL04 6.73e-90 271 51 0 276 3 folD Bifunctional protein FolD Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JAV4 6.73e-90 271 51 0 276 3 folD Bifunctional protein FolD Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q5XB24 6.73e-90 271 51 0 276 3 folD Bifunctional protein FolD Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DF88 6.73e-90 271 51 0 276 3 folD Bifunctional protein FolD Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q1WUJ3 6.87e-90 271 50 1 280 3 folD Bifunctional protein FolD Ligilactobacillus salivarius (strain UCC118)
Q48SM7 8.1e-90 271 51 0 276 3 folD Bifunctional protein FolD Streptococcus pyogenes serotype M28 (strain MGAS6180)
Q7CN13 8.1e-90 271 51 0 276 3 folD Bifunctional protein FolD Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q99YX2 8.1e-90 271 51 0 276 3 folD Bifunctional protein FolD Streptococcus pyogenes serotype M1
Q167Y9 8.52e-90 271 51 2 286 3 folD1 Bifunctional protein FolD 1 Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q1GE28 9.7e-90 271 51 2 286 3 folD Bifunctional protein FolD Ruegeria sp. (strain TM1040)
Q5NP22 1.01e-89 271 50 1 290 3 folD Bifunctional protein FolD Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q71ZW2 1.32e-89 271 49 1 278 3 folD Bifunctional protein FolD Listeria monocytogenes serotype 4b (strain F2365)
Q63SL6 1.87e-89 270 52 1 276 3 folD Bifunctional protein FolD Burkholderia pseudomallei (strain K96243)
A3NBC0 1.87e-89 270 52 1 276 3 folD Bifunctional protein FolD Burkholderia pseudomallei (strain 668)
Q3JQL8 1.87e-89 270 52 1 276 3 folD Bifunctional protein FolD Burkholderia pseudomallei (strain 1710b)
Q836W7 2.43e-89 270 47 1 277 3 folD Bifunctional protein FolD Enterococcus faecalis (strain ATCC 700802 / V583)
Q2SXF8 3.19e-89 270 52 1 276 3 folD Bifunctional protein FolD Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q9K966 3.45e-89 269 50 2 281 3 folD Bifunctional protein FolD Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q7VVW3 5.45e-89 269 50 1 281 3 folD2 Bifunctional protein FolD 2 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
B8DFW8 5.51e-89 269 49 1 278 3 folD Bifunctional protein FolD Listeria monocytogenes serotype 4a (strain HCC23)
B3QUL4 5.68e-89 269 48 3 290 3 folD Bifunctional protein FolD Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
Q8XZ10 5.81e-89 269 52 1 276 3 folD Bifunctional protein FolD Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q75TC1 7.47e-89 269 51 1 285 3 folD Bifunctional protein FolD Geobacillus kaustophilus (strain HTA426)
A3NX53 7.8e-89 269 52 1 276 3 folD Bifunctional protein FolD Burkholderia pseudomallei (strain 1106a)
C1L2R6 8.51e-89 268 49 1 278 3 folD Bifunctional protein FolD Listeria monocytogenes serotype 4b (strain CLIP80459)
Q316P9 1.14e-88 268 48 2 281 3 folD Bifunctional protein FolD Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q7W4Z7 1.67e-88 268 50 1 281 3 folD2 Bifunctional protein FolD 2 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
A7HDC5 1.69e-88 268 52 2 274 3 folD Bifunctional protein FolD Anaeromyxobacter sp. (strain Fw109-5)
A1V5P2 1.75e-88 268 52 1 276 3 folD Bifunctional protein FolD Burkholderia mallei (strain SAVP1)
Q62IX5 1.75e-88 268 52 1 276 3 folD Bifunctional protein FolD Burkholderia mallei (strain ATCC 23344)
A2SAQ8 1.75e-88 268 52 1 276 3 folD Bifunctional protein FolD Burkholderia mallei (strain NCTC 10229)
A3MLB7 1.75e-88 268 52 1 276 3 folD Bifunctional protein FolD Burkholderia mallei (strain NCTC 10247)
A8I5P5 1.78e-88 268 51 1 285 3 folD Bifunctional protein FolD Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
A1VN60 1.81e-88 268 50 1 280 3 folD Bifunctional protein FolD Polaromonas naphthalenivorans (strain CJ2)
C0M7V0 1.95e-88 268 50 0 276 3 folD Bifunctional protein FolD Streptococcus equi subsp. equi (strain 4047)
Q0BNF1 2.32e-88 267 51 2 280 3 folD Bifunctional protein FolD Francisella tularensis subsp. holarctica (strain OSU18)
Q2A535 2.32e-88 267 51 2 280 3 folD Bifunctional protein FolD Francisella tularensis subsp. holarctica (strain LVS)
A7NA91 2.32e-88 267 51 2 280 3 folD Bifunctional protein FolD Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
A0M554 2.93e-88 268 48 3 291 3 folD Bifunctional protein FolD Christiangramia forsetii (strain DSM 17595 / CGMCC 1.15422 / KT0803)
C0MD36 2.95e-88 267 50 0 276 3 folD Bifunctional protein FolD Streptococcus equi subsp. zooepidemicus (strain H70)
C4XLR8 3.28e-88 267 48 1 278 3 folD Bifunctional protein FolD Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
Q8Y7C5 3.4e-88 267 49 1 278 3 folD Bifunctional protein FolD Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
B4U1W4 3.47e-88 267 50 0 276 3 folD Bifunctional protein FolD Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
A8FF15 3.51e-88 267 49 1 280 3 folD Bifunctional protein FolD Bacillus pumilus (strain SAFR-032)
Q65HI8 4.46e-88 267 48 1 280 3 folD Bifunctional protein FolD Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
A1B5A7 5.82e-88 267 51 1 282 3 folD1 Bifunctional protein FolD 1 Paracoccus denitrificans (strain Pd 1222)
A4VTM4 6.18e-88 266 48 0 275 3 folD Bifunctional protein FolD Streptococcus suis (strain 05ZYH33)
A2SHP8 7.05e-88 266 48 1 282 3 folD Bifunctional protein FolD Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
A4XXZ2 9.17e-88 266 49 2 286 3 folD2 Bifunctional protein FolD 2 Pseudomonas mendocina (strain ymp)
A7ZCH3 1.03e-87 266 48 1 277 3 folD Bifunctional protein FolD Campylobacter concisus (strain 13826)
B9DUU0 1.09e-87 266 47 0 276 3 folD Bifunctional protein FolD Streptococcus uberis (strain ATCC BAA-854 / 0140J)
A7GSJ9 1.21e-87 266 47 1 280 3 folD Bifunctional protein FolD Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
A5EX57 1.59e-87 266 52 2 280 3 folD Bifunctional protein FolD Dichelobacter nodosus (strain VCS1703A)
B8D2H8 2.47e-87 265 51 4 283 3 folD Bifunctional protein FolD Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)
Q2JQ25 2.8e-87 265 49 1 284 3 folD Bifunctional protein FolD Synechococcus sp. (strain JA-2-3B'a(2-13))
Q9LHH7 2.91e-87 265 50 2 287 2 FOLD2 Bifunctional protein FolD 2 Arabidopsis thaliana
A0RQ49 4.11e-87 264 49 1 277 3 folD Bifunctional protein FolD Campylobacter fetus subsp. fetus (strain 82-40)
Q818R5 4.63e-87 264 47 1 280 3 folD Bifunctional protein FolD Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B8HXS0 6.2e-87 264 46 1 281 3 folD Bifunctional protein FolD Cyanothece sp. (strain PCC 7425 / ATCC 29141)
Q81M50 6.22e-87 264 47 1 280 3 folD Bifunctional protein FolD Bacillus anthracis
C3LJV5 6.22e-87 264 47 1 280 3 folD Bifunctional protein FolD Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P7W0 6.22e-87 264 47 1 280 3 folD Bifunctional protein FolD Bacillus anthracis (strain A0248)
B8DMA9 6.93e-87 264 52 2 276 3 folD Bifunctional protein FolD Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
Q8EQ43 7.73e-87 263 46 1 282 3 folD Bifunctional protein FolD Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
A3CLQ4 9.11e-87 263 48 0 278 3 folD Bifunctional protein FolD Streptococcus sanguinis (strain SK36)
Q160C1 9.13e-87 264 49 2 286 3 folD2 Bifunctional protein FolD 2 Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
B0C3J3 9.46e-87 264 46 1 285 3 folD Bifunctional protein FolD Acaryochloris marina (strain MBIC 11017)
B7IXH2 1.03e-86 263 47 1 280 3 folD Bifunctional protein FolD Bacillus cereus (strain G9842)
Q9ZLQ4 1.05e-86 263 45 0 281 3 folD Bifunctional protein FolD Helicobacter pylori (strain J99 / ATCC 700824)
Q2JT84 1.14e-86 263 48 1 284 3 folD Bifunctional protein FolD Synechococcus sp. (strain JA-3-3Ab)
C5CXD8 1.2e-86 263 48 1 280 3 folD Bifunctional protein FolD Variovorax paradoxus (strain S110)
Q030A3 1.25e-86 263 48 1 275 3 folD Bifunctional protein FolD Lactococcus lactis subsp. cremoris (strain SK11)
A2RLU5 1.25e-86 263 48 1 275 3 folD Bifunctional protein FolD Lactococcus lactis subsp. cremoris (strain MG1363)
A8ESH8 1.29e-86 263 46 0 276 3 folD Bifunctional protein FolD Aliarcobacter butzleri (strain RM4018)
Q9X7F6 1.41e-86 264 47 2 284 3 folD Bifunctional protein FolD Methylorubrum extorquens (strain CM4 / NCIMB 13688)
B9MIU6 1.44e-86 263 48 2 283 3 folD Bifunctional protein FolD Acidovorax ebreus (strain TPSY)
A5VAA8 1.68e-86 263 53 2 283 3 folD3 Bifunctional protein FolD 3 Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
C0ZC05 1.77e-86 263 47 1 281 3 folD Bifunctional protein FolD Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
Q17W13 1.9e-86 263 45 0 281 3 folD Bifunctional protein FolD Helicobacter acinonychis (strain Sheeba)
A4VZV9 2.04e-86 262 48 0 275 3 folD Bifunctional protein FolD Streptococcus suis (strain 98HAH33)
Q6HDY4 2.08e-86 263 47 1 280 3 folD Bifunctional protein FolD Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q635A3 2.08e-86 263 47 1 280 3 folD Bifunctional protein FolD Bacillus cereus (strain ZK / E33L)
C1ERQ4 2.08e-86 263 47 1 280 3 folD Bifunctional protein FolD Bacillus cereus (strain 03BB102)
B7JM32 2.08e-86 263 47 1 280 3 folD Bifunctional protein FolD Bacillus cereus (strain AH820)
A0RIH3 2.08e-86 263 47 1 280 3 folD Bifunctional protein FolD Bacillus thuringiensis (strain Al Hakam)
A9VGW3 2.1e-86 263 47 1 280 3 folD Bifunctional protein FolD Bacillus mycoides (strain KBAB4)
B9IXH4 2.15e-86 263 47 1 280 3 folD Bifunctional protein FolD Bacillus cereus (strain Q1)
B7HNU4 2.15e-86 263 47 1 280 3 folD Bifunctional protein FolD Bacillus cereus (strain AH187)
Q7UNN9 2.23e-86 263 48 3 295 3 folD Bifunctional protein FolD Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
A8AW32 2.25e-86 262 47 0 278 3 folD Bifunctional protein FolD Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
B7JVV5 2.7e-86 263 45 1 287 3 folD Bifunctional protein FolD Rippkaea orientalis (strain PCC 8801 / RF-1)
A1VZJ8 2.83e-86 262 49 2 277 3 folD Bifunctional protein FolD Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
A8FLR4 2.83e-86 262 49 2 277 3 folD Bifunctional protein FolD Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
B7HB52 2.89e-86 262 47 1 280 3 folD Bifunctional protein FolD Bacillus cereus (strain B4264)
Q07VM6 3.1e-86 262 49 1 288 3 folD Bifunctional protein FolD Rhodopseudomonas palustris (strain BisA53)
A1BBS1 3.19e-86 263 51 1 278 3 folD2 Bifunctional protein FolD 2 Paracoccus denitrificans (strain Pd 1222)
Q11M18 3.27e-86 263 49 5 293 3 folD Bifunctional protein FolD Chelativorans sp. (strain BNC1)
A5FNE3 3.31e-86 262 47 2 285 3 folD Bifunctional protein FolD Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / BCRC 14874 / CCUG 350202 / NBRC 14942 / NCIMB 11054 / UW101)
A4XLE0 3.56e-86 262 49 3 272 3 folD Bifunctional protein FolD Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
Q731B2 3.63e-86 262 46 1 280 3 folD Bifunctional protein FolD Bacillus cereus (strain ATCC 10987 / NRS 248)
Q3YRE3 3.64e-86 262 49 3 287 3 folD Bifunctional protein FolD Ehrlichia canis (strain Jake)
B2A532 3.79e-86 262 49 2 279 3 folD Bifunctional protein FolD Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
A1TPZ6 4.18e-86 261 48 1 280 3 folD Bifunctional protein FolD Paracidovorax citrulli (strain AAC00-1)
A6SVR5 4.87e-86 261 50 1 280 3 folD Bifunctional protein FolD Janthinobacterium sp. (strain Marseille)
P56467 4.96e-86 262 45 0 281 3 folD Bifunctional protein FolD Helicobacter pylori (strain ATCC 700392 / 26695)
Q2IQE1 5.04e-86 261 50 2 274 3 folD Bifunctional protein FolD Anaeromyxobacter dehalogenans (strain 2CP-C)
B1YLQ1 6.34e-86 261 48 2 278 3 folD Bifunctional protein FolD Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
Q6W210 6.65e-86 262 51 6 296 3 folD Bifunctional protein FolD Sinorhizobium fredii (strain NBRC 101917 / NGR234)
B2J442 7.26e-86 261 46 1 288 3 folD Bifunctional protein FolD Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
Q5HUU1 8.04e-86 261 49 2 277 3 folD Bifunctional protein FolD Campylobacter jejuni (strain RM1221)
Q1CTU9 9.43e-86 261 45 0 281 3 folD Bifunctional protein FolD Helicobacter pylori (strain HPAG1)
Q11UD1 9.85e-86 261 47 3 288 3 folD Bifunctional protein FolD Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
Q4FNW1 1.15e-85 260 48 1 273 3 folD Bifunctional protein FolD Pelagibacter ubique (strain HTCC1062)
Q9CH85 1.27e-85 260 48 1 275 3 folD Bifunctional protein FolD Lactococcus lactis subsp. lactis (strain IL1403)
A4G352 1.34e-85 260 50 1 280 3 folD Bifunctional protein FolD Herminiimonas arsenicoxydans
B4SGR4 1.47e-85 261 46 3 292 3 folD Bifunctional protein FolD Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
A1W7S2 1.8e-85 260 48 2 283 3 folD Bifunctional protein FolD Acidovorax sp. (strain JS42)
Q8DVC1 1.82e-85 260 50 0 276 3 folD Bifunctional protein FolD Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q0PA35 2.03e-85 260 49 2 277 1 folD Bifunctional protein FolD Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
B1HRX9 2.19e-85 260 50 1 280 3 folD Bifunctional protein FolD Lysinibacillus sphaericus (strain C3-41)
A9BWT7 2.26e-85 260 48 2 281 3 folD Bifunctional protein FolD Delftia acidovorans (strain DSM 14801 / SPH-1)
B8GG34 2.64e-85 259 48 4 284 3 folD Bifunctional protein FolD Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c)
Q97RI9 2.69e-85 259 47 0 282 3 folD Bifunctional protein FolD Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
B6IVC0 3.23e-85 260 52 1 287 3 folD Bifunctional protein FolD Rhodospirillum centenum (strain ATCC 51521 / SW)
Q5P922 4.1e-85 259 47 2 284 3 folD Bifunctional protein FolD Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q13WX0 4.68e-85 259 51 1 276 3 folD Bifunctional protein FolD Paraburkholderia xenovorans (strain LB400)
Q8CPP4 5.34e-85 259 47 1 278 3 folD Bifunctional protein FolD Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q2GHD8 6.57e-85 259 49 3 287 3 folD Bifunctional protein FolD Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas)
Q4L572 7.32e-85 258 47 1 278 3 folD Bifunctional protein FolD Staphylococcus haemolyticus (strain JCSC1435)
Q5HQA7 7.73e-85 258 47 1 278 3 folD Bifunctional protein FolD Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
A7H3N3 7.83e-85 258 49 2 275 3 folD Bifunctional protein FolD Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
B2T5N8 8.25e-85 258 51 1 276 3 folD Bifunctional protein FolD Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
A6GZM5 9.87e-85 258 47 3 287 3 folD Bifunctional protein FolD Flavobacterium psychrophilum (strain ATCC 49511 / DSM 21280 / CIP 103535 / JIP02/86)
Q48HJ1 1.03e-84 259 47 2 284 3 folD2 Bifunctional protein FolD 2 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
B3ECA6 1.1e-84 258 47 3 288 3 folD Bifunctional protein FolD Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
Q4ZUA4 1.11e-84 259 50 2 284 3 folD2 Bifunctional protein FolD 2 Pseudomonas syringae pv. syringae (strain B728a)
A4YK09 1.54e-84 258 48 1 283 3 folD Bifunctional protein FolD Bradyrhizobium sp. (strain ORS 278)
A5E8S0 1.7e-84 258 48 1 283 3 folD Bifunctional protein FolD Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
B9DQ45 1.83e-84 258 47 1 278 3 folD Bifunctional protein FolD Staphylococcus carnosus (strain TM300)
A1BF67 2.23e-84 258 47 3 293 3 folD Bifunctional protein FolD Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
B1WRW8 2.58e-84 257 46 1 284 3 folD Bifunctional protein FolD Crocosphaera subtropica (strain ATCC 51142 / BH68)
Q038F9 2.79e-84 257 48 1 271 3 folD Bifunctional protein FolD Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q21D98 3.34e-84 257 47 1 288 3 folD Bifunctional protein FolD Rhodopseudomonas palustris (strain BisB18)
B0KLM9 3.39e-84 258 52 3 280 3 folD2 Bifunctional protein FolD 2 Pseudomonas putida (strain GB-1)
Q6F9E6 3.41e-84 257 48 3 286 3 folD1 Bifunctional protein FolD 1 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q2J3Z0 3.97e-84 257 47 1 288 3 folD Bifunctional protein FolD Rhodopseudomonas palustris (strain HaA2)
Q8DQD3 5.25e-84 256 47 0 282 3 folD Bifunctional protein FolD Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q04L84 5.25e-84 256 47 0 282 3 folD Bifunctional protein FolD Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q7NJE8 5.35e-84 256 46 2 286 3 folD Bifunctional protein FolD Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
A4XY05 5.44e-84 257 50 3 278 3 folD3 Bifunctional protein FolD 3 Pseudomonas mendocina (strain ymp)
C0R2N7 5.76e-84 256 48 2 277 3 folD Bifunctional protein FolD Wolbachia sp. subsp. Drosophila simulans (strain wRi)
Q2N7E3 6.12e-84 256 48 1 285 3 folD Bifunctional protein FolD Erythrobacter litoralis (strain HTCC2594)
B4RE11 1.39e-83 256 48 1 292 3 folD Bifunctional protein FolD Phenylobacterium zucineum (strain HLK1)
Q21WC0 1.46e-83 255 48 1 278 3 folD Bifunctional protein FolD Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
A5G1W5 1.46e-83 255 53 1 279 3 folD Bifunctional protein FolD Acidiphilium cryptum (strain JF-5)
Q5FST0 1.77e-83 256 50 2 281 3 folD Bifunctional protein FolD Gluconobacter oxydans (strain 621H)
A0LLR2 1.94e-83 255 47 4 294 3 folD Bifunctional protein FolD Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
Q12A51 2.1e-83 254 48 1 282 3 folD Bifunctional protein FolD Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q3ASI0 2.24e-83 255 45 3 291 3 folD Bifunctional protein FolD Chlorobium chlorochromatii (strain CaD3)
Q13DA7 2.26e-83 255 47 1 288 3 folD Bifunctional protein FolD Rhodopseudomonas palustris (strain BisB5)
B3EJG9 3.45e-83 255 45 3 292 3 folD Bifunctional protein FolD Chlorobium phaeobacteroides (strain BS1)
A9HEL1 3.63e-83 255 51 2 285 3 folD Bifunctional protein FolD Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
Q82XC3 3.99e-83 254 48 1 280 3 folD Bifunctional protein FolD Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
B3WEY4 4.06e-83 254 47 1 271 3 folD Bifunctional protein FolD Lacticaseibacillus casei (strain BL23)
Q49WI7 4.48e-83 254 47 1 278 3 folD Bifunctional protein FolD Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q8PZQ1 4.67e-83 254 46 1 279 3 folD Bifunctional protein FolD Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q7MVE9 4.95e-83 254 46 2 292 3 folD Bifunctional protein FolD Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
Q1II76 5e-83 254 46 4 302 3 folD Bifunctional protein FolD Koribacter versatilis (strain Ellin345)
B3QA91 5.35e-83 254 47 2 288 3 folD Bifunctional protein FolD Rhodopseudomonas palustris (strain TIE-1)
Q6NCQ6 5.35e-83 254 47 2 288 3 folD Bifunctional protein FolD Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q03RR1 9.16e-83 253 50 2 278 3 folD Bifunctional protein FolD Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q6MAH4 9.96e-83 253 49 5 283 3 folD Bifunctional protein FolD Protochlamydia amoebophila (strain UWE25)
A0AIG1 3.25e-82 252 50 1 278 3 folD Bifunctional protein FolD Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q67NB1 3.42e-82 252 49 2 281 3 folD Bifunctional protein FolD Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
A8ZTQ4 3.63e-82 252 49 4 297 3 folD Bifunctional protein FolD Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
B6JAU5 4.46e-82 252 48 2 282 3 folD Bifunctional protein FolD Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
Q73HK3 4.62e-82 252 47 2 277 3 folD Bifunctional protein FolD Wolbachia pipientis wMel
Q6GI21 6.64e-82 251 46 1 278 3 folD Bifunctional protein FolD Staphylococcus aureus (strain MRSA252)
B4S820 6.81e-82 251 46 3 292 3 folD Bifunctional protein FolD Prosthecochloris aestuarii (strain DSM 271 / SK 413)
Q2YX11 7.74e-82 251 46 1 278 3 folD Bifunctional protein FolD Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2FR55 7.78e-82 251 49 3 271 3 folD Bifunctional protein FolD Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1)
A5V4U1 9.04e-82 251 51 2 288 3 folD1 Bifunctional protein FolD 1 Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
B3CLT4 1.09e-81 251 48 2 278 3 folD Bifunctional protein FolD Wolbachia pipientis subsp. Culex pipiens (strain wPip)
Q1GNH1 1.31e-81 251 47 1 285 3 folD Bifunctional protein FolD Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
Q5HAK8 1.45e-81 251 47 3 287 3 folD Bifunctional protein FolD Ehrlichia ruminantium (strain Welgevonden)
A3CWL0 1.73e-81 250 51 0 247 3 folD Bifunctional protein FolD Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1)
A7HSV9 1.89e-81 250 47 3 289 3 folD Bifunctional protein FolD Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
Q1DA76 1.94e-81 250 48 4 288 3 folD1 Bifunctional protein FolD 1 Myxococcus xanthus (strain DK1622)
Q2S1I0 2.27e-81 250 46 3 285 3 folD Bifunctional protein FolD Salinibacter ruber (strain DSM 13855 / M31)
Q89WX9 2.43e-81 250 48 2 283 3 folD Bifunctional protein FolD Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q14NV1 2.82e-81 249 46 0 273 3 folD Bifunctional protein FolD Spiroplasma citri
Q8NX95 3.4e-81 249 45 1 278 3 folD Bifunctional protein FolD Staphylococcus aureus (strain MW2)
A8Z1K5 3.4e-81 249 45 1 278 3 folD Bifunctional protein FolD Staphylococcus aureus (strain USA300 / TCH1516)
Q6GAF0 3.4e-81 249 45 1 278 3 folD Bifunctional protein FolD Staphylococcus aureus (strain MSSA476)
A6QFS2 3.4e-81 249 45 1 278 3 folD Bifunctional protein FolD Staphylococcus aureus (strain Newman)
Q5HH21 3.4e-81 249 45 1 278 3 folD Bifunctional protein FolD Staphylococcus aureus (strain COL)
Q2FZJ6 3.4e-81 249 45 1 278 3 folD Bifunctional protein FolD Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FI15 3.4e-81 249 45 1 278 3 folD Bifunctional protein FolD Staphylococcus aureus (strain USA300)
B4U8W9 3.45e-81 249 47 3 279 3 folD Bifunctional protein FolD Hydrogenobaculum sp. (strain Y04AAS1)
Q2GCV3 4.31e-81 249 47 3 275 3 folD Bifunctional protein FolD Neorickettsia sennetsu (strain ATCC VR-367 / Miyayama)
A0B8J7 4.53e-81 249 48 2 276 3 folD Bifunctional protein FolD Methanothrix thermoacetophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT)
B8FLE5 4.53e-81 249 47 4 294 3 folD Bifunctional protein FolD Desulfatibacillum aliphaticivorans
A5GRZ3 5.11e-81 249 44 0 284 3 folD Bifunctional protein FolD Synechococcus sp. (strain RCC307)
Q5FG00 6.36e-81 249 47 3 287 3 folD Bifunctional protein FolD Ehrlichia ruminantium (strain Gardel)
Q04448 7.4e-81 249 47 4 299 2 Nmdmc Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase, mitochondrial Drosophila melanogaster
Q5M583 7.69e-81 248 47 0 277 3 folD Bifunctional protein FolD Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q6ALZ5 8.95e-81 248 48 4 291 3 folD Bifunctional protein FolD Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q0AFN2 9.06e-81 248 46 1 276 3 folD Bifunctional protein FolD Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q03LK0 9.46e-81 248 47 0 277 3 folD Bifunctional protein FolD Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
B9EAY2 1.28e-80 248 45 2 280 3 folD Bifunctional protein FolD Macrococcus caseolyticus (strain JCSC5402)
Q3B4E2 1.35e-80 248 45 3 288 3 folD Bifunctional protein FolD Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
B2UM17 1.42e-80 248 45 4 287 3 folD Bifunctional protein FolD Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc)
Q28TR2 1.44e-80 248 46 1 291 3 folD Bifunctional protein FolD Jannaschia sp. (strain CCS1)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS16070
Feature type CDS
Gene folD
Product bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD
Location 17705 - 18568 (strand: 1)
Length 864 (nucleotides) / 287 (amino acids)

Contig

Accession term accessions NZ_VXKB01000006 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 212134 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_913
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00763 Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain
PF02882 Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0190 Coenzyme transport and metabolism (H) H 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase

Kegg Ortholog Annotation(s)

Protein Sequence

MSAKIIDGKTIAQTIRTEIAAKVKQRLAKGKRAPGLAVILVGENPASQIYVASKRRSCEEVGFISRSYDLPDTTSEATLLHLIDELNNDKTIDGILVQLPLPAGIDNVKVIERIHPDKDVDGFHPYNIGRLCQRAPNLRPCTPRGIVTLLERCNINTFGLNAVIVGASNIVGRPMSLELLLAGCTTTVTHRFTKDLRHHVEHADLLIVAVGKPGFIPGEWIKPGAIVIDVGINRLENGKVVGDVNFADAAERAEWITPVPGGVGPMTVATLIQNTLQACEEFHDKDE

Flanking regions ( +/- flanking 50bp)

TCTGACAGAATAGCGCCCATACTTTTATCTGTTTTATGGATTTTCACACAATGTCAGCAAAAATTATAGACGGGAAAACGATTGCGCAGACCATCCGGACAGAAATTGCCGCCAAAGTTAAGCAACGTCTGGCTAAGGGAAAACGGGCTCCCGGACTCGCCGTTATTTTAGTCGGCGAGAACCCCGCGTCTCAGATTTATGTCGCCAGCAAGCGCCGCTCCTGTGAAGAAGTCGGATTTATCTCACGCTCTTATGACCTGCCCGATACCACCAGCGAAGCCACACTCCTTCATCTTATTGATGAATTAAATAATGATAAGACCATTGACGGGATCCTGGTTCAGCTTCCGTTACCCGCCGGTATTGATAATGTCAAAGTAATTGAGCGCATCCATCCGGATAAAGATGTTGATGGCTTTCATCCGTATAATATCGGGCGTCTGTGCCAGCGCGCGCCAAATCTGCGCCCCTGCACACCACGTGGTATTGTAACGCTGCTGGAACGCTGTAATATCAACACCTTCGGGCTGAATGCCGTGATTGTCGGCGCATCCAATATTGTCGGGCGTCCGATGAGTCTGGAGCTTCTGCTGGCAGGTTGCACCACAACCGTCACCCACCGTTTCACCAAAGATCTGCGCCATCATGTTGAGCATGCGGATCTGCTGATCGTGGCTGTTGGTAAACCGGGCTTTATTCCCGGCGAGTGGATAAAACCCGGCGCTATCGTGATCGATGTCGGGATTAACCGCCTCGAGAACGGCAAAGTGGTGGGCGATGTTAATTTTGCCGACGCCGCCGAGCGCGCAGAATGGATAACCCCGGTACCGGGCGGTGTAGGCCCGATGACCGTCGCCACACTCATTCAGAACACATTACAGGCTTGTGAAGAATTTCACGATAAGGACGAATAACCATGGCTATTTTTAATCTCGAAGGGCACCCGCACGTTGAATTATGTGAT