Homologs in group_1162

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_06255 FBDBKF_06255 91.2 Morganella morganii S1 surA peptidylprolyl isomerase SurA
EHELCC_09300 EHELCC_09300 91.2 Morganella morganii S2 surA peptidylprolyl isomerase SurA
NLDBIP_09680 NLDBIP_09680 91.2 Morganella morganii S4 surA peptidylprolyl isomerase SurA
LHKJJB_08075 LHKJJB_08075 91.2 Morganella morganii S3 surA peptidylprolyl isomerase SurA
HKOGLL_07625 HKOGLL_07625 91.2 Morganella morganii S5 surA peptidylprolyl isomerase SurA
PMI_RS11535 PMI_RS11535 67.3 Proteus mirabilis HI4320 surA peptidylprolyl isomerase SurA

Distribution of the homologs in the orthogroup group_1162

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1162

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7N8V5 0.0 672 73 1 431 3 surA Chaperone SurA Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q66EQ7 0.0 630 70 1 431 3 surA Chaperone SurA Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1CMT0 0.0 630 70 1 431 3 surA Chaperone SurA Yersinia pestis bv. Antiqua (strain Nepal516)
Q7CG87 0.0 630 70 1 431 3 surA Chaperone SurA Yersinia pestis
Q1C0H3 0.0 627 69 1 431 3 surA Chaperone SurA Yersinia pestis bv. Antiqua (strain Antiqua)
Q57TG8 0.0 609 66 1 427 3 surA Chaperone SurA Salmonella choleraesuis (strain SC-B67)
Q7CR87 0.0 589 66 1 427 3 surA Chaperone SurA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XEV3 0.0 589 66 1 427 3 surA Chaperone SurA Salmonella typhi
Q5PDE6 0.0 589 66 1 427 3 surA Chaperone SurA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q3Z5V6 0.0 584 66 1 427 3 surA Chaperone SurA Shigella sonnei (strain Ss046)
P0ABZ9 0.0 584 66 1 427 3 surA Chaperone SurA Shigella flexneri
Q326I0 0.0 584 66 1 427 3 surA Chaperone SurA Shigella boydii serotype 4 (strain Sb227)
Q1RGE4 0.0 584 66 1 427 3 surA Chaperone SurA Escherichia coli (strain UTI89 / UPEC)
P0ABZ6 0.0 584 66 1 427 1 surA Chaperone SurA Escherichia coli (strain K12)
P0ABZ7 0.0 584 66 1 427 3 surA Chaperone SurA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ABZ8 0.0 584 66 1 427 1 surA Chaperone SurA Escherichia coli O157:H7
Q32K41 0.0 581 66 1 427 3 surA Chaperone SurA Shigella dysenteriae serotype 1 (strain Sd197)
Q6D0E2 0.0 576 63 1 430 3 surA Chaperone SurA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q2NVX4 0.0 567 63 1 432 3 surA Chaperone SurA Sodalis glossinidius (strain morsitans)
Q6LV39 3.07e-143 418 45 3 432 3 surA Chaperone SurA Photobacterium profundum (strain SS9)
Q7MP84 1.51e-136 401 44 4 429 3 surA Chaperone SurA Vibrio vulnificus (strain YJ016)
Q8EB95 2.06e-136 401 42 2 428 3 surA Chaperone SurA Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q8DED4 7.17e-136 399 44 4 429 3 surA Chaperone SurA Vibrio vulnificus (strain CMCP6)
Q0HLT0 1.08e-135 399 42 2 428 3 surA Chaperone SurA Shewanella sp. (strain MR-4)
Q5E863 1.31e-135 399 45 2 428 3 surA Chaperone SurA Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q0HS08 1.83e-135 399 42 2 428 3 surA Chaperone SurA Shewanella sp. (strain MR-7)
Q07YK0 5.66e-133 392 42 2 433 3 surA Chaperone SurA Shewanella frigidimarina (strain NCIMB 400)
Q87ST4 7.6e-132 389 41 3 431 3 surA Chaperone SurA Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q15QB3 3.53e-131 387 43 1 422 3 surA Chaperone SurA Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q12K61 1.17e-130 386 41 2 429 3 surA Chaperone SurA Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q47VK0 2.06e-129 383 44 2 422 3 surA Chaperone SurA Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q9KUS0 2.04e-128 380 42 4 429 3 surA Chaperone SurA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q3IFD3 3.68e-124 370 43 1 417 3 surA Chaperone SurA Pseudoalteromonas translucida (strain TAC 125)
Q1LSS0 9.14e-104 317 39 3 421 3 surA Chaperone SurA Baumannia cicadellinicola subsp. Homalodisca coagulata
Q5QVN9 1.89e-100 309 39 1 386 3 surA Chaperone SurA Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q1QZ33 4.44e-98 303 38 4 423 3 surA Chaperone SurA Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q4K4X7 2.56e-95 296 37 3 419 3 surA Chaperone SurA Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q3K5T4 2.91e-95 295 37 4 426 3 surA Chaperone SurA Pseudomonas fluorescens (strain Pf0-1)
Q1GZC0 1.13e-94 294 36 3 422 3 surA Chaperone SurA Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q0VMV4 3.33e-94 293 35 1 406 3 surA Chaperone SurA Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q21MS8 6.52e-94 292 34 4 420 3 surA Chaperone SurA Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q3JAF1 4.3e-93 290 34 2 421 3 surA Chaperone SurA Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q88QT4 1e-92 289 37 3 426 3 surA Chaperone SurA Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q88A44 2.81e-90 283 37 5 422 3 surA Chaperone SurA Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q9I5U3 5.12e-90 281 37 3 417 3 surA Chaperone SurA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q4ZMG7 3.76e-89 280 36 3 420 3 surA Chaperone SurA Pseudomonas syringae pv. syringae (strain B728a)
Q5WZN0 5.47e-89 280 35 3 425 3 surA Chaperone SurA Legionella pneumophila (strain Lens)
Q48NT5 1.15e-88 278 36 5 422 3 surA Chaperone SurA Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q5ZYR3 2.42e-88 278 34 3 425 3 surA Chaperone SurA Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q5X877 3.8e-88 277 35 5 426 3 surA Chaperone SurA Legionella pneumophila (strain Paris)
Q60B78 1.67e-87 276 34 4 420 3 surA Chaperone SurA Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q3SGF9 4.12e-83 265 36 3 401 3 surA Chaperone SurA Thiobacillus denitrificans (strain ATCC 25259)
Q0AC82 3.5e-81 259 33 6 409 3 surA Chaperone SurA Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q5P7I9 5.8e-79 254 34 8 436 3 surA Chaperone SurA Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q2S9C1 6.81e-79 253 33 2 406 3 surA Chaperone SurA Hahella chejuensis (strain KCTC 2396)
Q8Y220 4.59e-78 253 35 7 428 3 surA Chaperone SurA Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q2KXA6 6.06e-78 253 32 6 456 3 surA Chaperone SurA Bordetella avium (strain 197N)
Q7WG19 3.62e-77 251 32 3 462 3 surA Chaperone SurA Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q82W17 3.97e-77 249 33 3 421 3 surA Chaperone SurA Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q7VU12 1.49e-76 250 32 3 462 3 surA Chaperone SurA Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W4J5 1.79e-76 250 32 3 462 3 surA Chaperone SurA Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7NQB0 1.9e-75 244 33 9 432 3 surA Chaperone SurA Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q1LRA3 2.31e-75 246 33 7 413 3 surA Chaperone SurA Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q479U4 6.56e-75 243 34 7 432 3 surA Chaperone SurA Dechloromonas aromatica (strain RCB)
Q121Q4 8.92e-75 244 35 3 404 3 surA Chaperone SurA Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q2YBP3 1.56e-74 243 33 4 421 3 surA Chaperone SurA Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q2NZI6 1.21e-73 241 31 5 426 3 surA Chaperone SurA Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q5GWC1 1.33e-73 241 31 5 426 3 surA Chaperone SurA Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q3BX80 2.11e-73 240 31 5 426 3 surA Chaperone SurA Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q475Q3 4.73e-73 240 34 6 416 3 surA Chaperone SurA Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q8PCE1 6.25e-73 239 31 6 427 3 surA Chaperone SurA Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UR41 6.25e-73 239 31 6 427 3 surA Chaperone SurA Xanthomonas campestris pv. campestris (strain 8004)
Q8PP23 1.46e-72 238 31 5 426 3 surA Chaperone SurA Xanthomonas axonopodis pv. citri (strain 306)
P57240 3.85e-71 233 30 6 417 3 surA Chaperone SurA Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q8KA01 5.41e-70 230 28 6 435 3 surA Chaperone SurA Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q87AJ0 1.74e-68 227 30 6 438 3 surA Chaperone SurA Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q223E5 1.84e-68 227 33 4 404 3 surA Chaperone SurA Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q9PF40 3.44e-68 227 30 6 439 3 surA Chaperone SurA Xylella fastidiosa (strain 9a5c)
Q145L3 2.55e-66 221 33 9 415 3 surA Chaperone SurA Paraburkholderia xenovorans (strain LB400)
Q39D35 1.11e-54 191 30 7 412 3 surA Chaperone SurA Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q1BTQ6 3.89e-54 189 30 8 413 3 surA Chaperone SurA Burkholderia orbicola (strain AU 1054)
Q2T116 2.58e-53 187 29 8 410 3 surA Chaperone SurA Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q493R5 6.95e-53 185 26 7 434 3 surA Chaperone SurA Blochmanniella pennsylvanica (strain BPEN)
Q31F26 1.54e-52 185 27 8 436 3 surA Chaperone SurA Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q3JVW8 1.61e-52 185 29 8 410 3 surA Chaperone SurA Burkholderia pseudomallei (strain 1710b)
Q63X78 2.2e-52 184 29 8 410 3 surA Chaperone SurA Burkholderia pseudomallei (strain K96243)
Q62MM4 2.88e-52 184 29 8 410 3 surA Chaperone SurA Burkholderia mallei (strain ATCC 23344)
P44721 2.26e-30 122 34 0 154 3 surA Putative peptidyl-prolyl cis-trans isomerase SurA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P44721 5.16e-20 93 25 8 320 3 surA Putative peptidyl-prolyl cis-trans isomerase SurA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q7WCX5 1.56e-20 94 45 2 105 3 BB3803 Probable parvulin-type peptidyl-prolyl cis-trans isomerase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q7WCX5 3.19e-06 52 23 10 276 3 BB3803 Probable parvulin-type peptidyl-prolyl cis-trans isomerase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
P40415 2.56e-20 93 45 2 105 2 BP3561 Probable parvulin-type peptidyl-prolyl cis-trans isomerase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
P40415 4.01e-06 51 23 10 276 2 BP3561 Probable parvulin-type peptidyl-prolyl cis-trans isomerase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W5E0 2.56e-20 93 45 2 105 3 BPP3352 Probable parvulin-type peptidyl-prolyl cis-trans isomerase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7W5E0 4.01e-06 51 23 10 276 3 BPP3352 Probable parvulin-type peptidyl-prolyl cis-trans isomerase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q81GY5 4.31e-16 81 39 4 114 3 prsA1 Foldase protein PrsA 1 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q81GY5 4.71e-06 51 32 3 103 3 prsA1 Foldase protein PrsA 1 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q81U45 5.64e-16 81 38 4 119 1 prsA1 Foldase protein PrsA 1 Bacillus anthracis
Q81U45 5.88e-06 51 24 9 211 1 prsA1 Foldase protein PrsA 1 Bacillus anthracis
C5D6L9 1.98e-14 76 37 3 113 3 prsA Foldase protein PrsA Geobacillus sp. (strain WCH70)
C5D6L9 1.76e-08 58 40 3 76 3 prsA Foldase protein PrsA Geobacillus sp. (strain WCH70)
Q81CB1 4e-14 75 38 4 115 1 prsA4 Foldase protein PrsA 4 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q81CB1 2.36e-06 52 21 11 276 1 prsA4 Foldase protein PrsA 4 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q5L289 2.08e-13 73 29 4 182 3 prsA Foldase protein PrsA Geobacillus kaustophilus (strain HTA426)
Q5L289 4.01e-09 60 37 5 101 3 prsA Foldase protein PrsA Geobacillus kaustophilus (strain HTA426)
P60749 2.11e-13 74 40 1 100 3 prsA Foldase protein PrsA Staphylococcus aureus (strain MW2)
P60749 6.1e-06 51 23 6 224 3 prsA Foldase protein PrsA Staphylococcus aureus (strain MW2)
A8YY10 2.11e-13 74 40 1 100 3 prsA Foldase protein PrsA Staphylococcus aureus (strain USA300 / TCH1516)
A8YY10 6.1e-06 51 23 6 224 3 prsA Foldase protein PrsA Staphylococcus aureus (strain USA300 / TCH1516)
Q6G894 2.11e-13 74 40 1 100 3 prsA Foldase protein PrsA Staphylococcus aureus (strain MSSA476)
Q6G894 6.1e-06 51 23 6 224 3 prsA Foldase protein PrsA Staphylococcus aureus (strain MSSA476)
P60748 2.11e-13 74 40 1 100 1 prsA Foldase protein PrsA Staphylococcus aureus (strain N315)
P60748 6.1e-06 51 23 6 224 1 prsA Foldase protein PrsA Staphylococcus aureus (strain N315)
P60747 2.11e-13 74 40 1 100 1 prsA Foldase protein PrsA Staphylococcus aureus (strain Mu50 / ATCC 700699)
P60747 6.1e-06 51 23 6 224 1 prsA Foldase protein PrsA Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QI23 2.11e-13 74 40 1 100 3 prsA Foldase protein PrsA Staphylococcus aureus (strain Newman)
A6QI23 6.1e-06 51 23 6 224 3 prsA Foldase protein PrsA Staphylococcus aureus (strain Newman)
Q5HET4 2.11e-13 74 40 1 100 3 prsA Foldase protein PrsA Staphylococcus aureus (strain COL)
Q5HET4 6.1e-06 51 23 6 224 3 prsA Foldase protein PrsA Staphylococcus aureus (strain COL)
Q2G2S6 2.11e-13 74 40 1 100 3 prsA Foldase protein PrsA Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2G2S6 6.1e-06 51 23 6 224 3 prsA Foldase protein PrsA Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FFQ5 2.11e-13 74 40 1 100 3 prsA Foldase protein PrsA Staphylococcus aureus (strain USA300)
Q2FFQ5 6.1e-06 51 23 6 224 3 prsA Foldase protein PrsA Staphylococcus aureus (strain USA300)
A6U2U4 2.11e-13 74 40 1 100 3 prsA Foldase protein PrsA Staphylococcus aureus (strain JH1)
A6U2U4 6.1e-06 51 23 6 224 3 prsA Foldase protein PrsA Staphylococcus aureus (strain JH1)
A7X3U8 2.11e-13 74 40 1 100 3 prsA Foldase protein PrsA Staphylococcus aureus (strain Mu3 / ATCC 700698)
A7X3U8 6.1e-06 51 23 6 224 3 prsA Foldase protein PrsA Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q2YTZ6 4.39e-13 73 40 1 100 3 prsA Foldase protein PrsA Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2YTZ6 4.15e-06 52 23 6 224 3 prsA Foldase protein PrsA Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q6GFL5 4.64e-13 73 40 1 100 3 prsA Foldase protein PrsA Staphylococcus aureus (strain MRSA252)
Q6GFL5 1.2e-06 53 24 6 224 3 prsA Foldase protein PrsA Staphylococcus aureus (strain MRSA252)
Q8CXK4 1.3e-11 68 31 3 126 3 prsA Foldase protein PrsA Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q8CXK4 9.62e-09 60 34 3 111 3 prsA Foldase protein PrsA Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
A4IKU2 2.31e-11 67 34 2 98 3 prsA Foldase protein PrsA Geobacillus thermodenitrificans (strain NG80-2)
A4IKU2 2.54e-09 61 36 3 97 3 prsA Foldase protein PrsA Geobacillus thermodenitrificans (strain NG80-2)
Q81QT1 7.69e-11 66 32 3 115 1 prsA3 Foldase protein PrsA 3 Bacillus anthracis
Q81GN0 1.19e-10 65 36 4 113 3 prsA2 Foldase protein PrsA 2 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q81GN0 4.52e-05 48 22 8 222 3 prsA2 Foldase protein PrsA 2 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q81DT1 3.83e-10 63 31 3 115 3 prsA3 Foldase protein PrsA 3 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q81DT1 0.001 44 28 6 114 3 prsA3 Foldase protein PrsA 3 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q81TU1 6.19e-10 63 34 4 115 1 prsA2 Foldase protein PrsA 2 Bacillus anthracis
P24327 6.29e-10 63 37 5 101 1 prsA Foldase protein PrsA Bacillus subtilis (strain 168)
P24327 5.41e-08 57 30 2 104 1 prsA Foldase protein PrsA Bacillus subtilis (strain 168)
A1VYV6 3.73e-09 60 35 4 106 3 cbf2 Putative peptidyl-prolyl cis-trans isomerase Cbf2 Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q0PAS1 3.95e-09 60 35 4 106 1 cbf2 Putative peptidyl-prolyl cis-trans isomerase Cbf2 Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q71XE6 4.77e-09 60 29 4 145 3 prsA2 Foldase protein PrsA 2 Listeria monocytogenes serotype 4b (strain F2365)
Q8Y557 5.22e-09 60 29 4 145 3 prsA2 Foldase protein PrsA 2 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
A5I7R3 5.97e-09 60 37 4 94 3 prsA Foldase protein PrsA Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A5I7R3 2.74e-08 58 25 9 218 3 prsA Foldase protein PrsA Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FPK5 5.97e-09 60 37 4 94 3 prsA Foldase protein PrsA Clostridium botulinum (strain ATCC 19397 / Type A)
A7FPK5 2.74e-08 58 25 9 218 3 prsA Foldase protein PrsA Clostridium botulinum (strain ATCC 19397 / Type A)
Q899I2 6.88e-09 60 32 7 149 3 prsA Foldase protein PrsA Clostridium tetani (strain Massachusetts / E88)
Q899I2 1.28e-06 53 24 8 227 3 prsA Foldase protein PrsA Clostridium tetani (strain Massachusetts / E88)
C3KW94 1.41e-08 59 28 6 141 3 prsA Foldase protein PrsA Clostridium botulinum (strain 657 / Type Ba4)
C3KW94 7.96e-06 51 23 12 294 3 prsA Foldase protein PrsA Clostridium botulinum (strain 657 / Type Ba4)
A7GJD2 2.76e-08 58 36 4 94 3 prsA Foldase protein PrsA Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
A7GJD2 3.67e-07 55 24 9 218 3 prsA Foldase protein PrsA Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
Q929F4 3.8e-08 58 31 7 148 3 prsA2 Foldase protein PrsA 2 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
C1FNE4 4.83e-08 58 36 4 94 3 prsA Foldase protein PrsA Clostridium botulinum (strain Kyoto / Type A2)
C1FNE4 1.67e-06 53 24 9 218 3 prsA Foldase protein PrsA Clostridium botulinum (strain Kyoto / Type A2)
B1IGZ5 5e-08 58 36 4 94 3 prsA Foldase protein PrsA Clostridium botulinum (strain Okra / Type B1)
B1IGZ5 1.7e-06 53 24 9 218 3 prsA Foldase protein PrsA Clostridium botulinum (strain Okra / Type B1)
Q92BR2 5.64e-08 57 37 5 107 3 prsA1 Foldase protein PrsA 1 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q71ZM6 1.12e-07 56 36 5 108 3 prsA1 Foldase protein PrsA 1 Listeria monocytogenes serotype 4b (strain F2365)
Q8Y759 1.39e-07 56 36 5 108 1 prsA1 Foldase protein PrsA 1 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q8CNR4 1.45e-07 56 34 1 100 3 prsA Foldase protein PrsA Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q9SL42 1.62e-07 53 35 2 112 1 PIN1 Peptidyl-prolyl cis-trans isomerase Pin1 Arabidopsis thaliana
P0ADY1 1.96e-07 57 23 12 361 1 ppiD Periplasmic chaperone PpiD Escherichia coli (strain K12)
P0ADY2 1.96e-07 57 23 12 361 3 ppiD Periplasmic chaperone PpiD Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q9ZCX6 2.35e-07 55 26 5 163 3 plp Parvulin-like PPIase Rickettsia prowazekii (strain Madrid E)
Q9ZCX6 0.000538 45 25 5 143 3 plp Parvulin-like PPIase Rickettsia prowazekii (strain Madrid E)
A5N4J2 4.03e-07 55 21 9 220 3 prsA Foldase protein PrsA Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
A5N4J2 1.08e-06 53 36 4 94 3 prsA Foldase protein PrsA Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9DY54 4.03e-07 55 21 9 220 3 prsA Foldase protein PrsA Clostridium kluyveri (strain NBRC 12016)
B9DY54 1.08e-06 53 36 4 94 3 prsA Foldase protein PrsA Clostridium kluyveri (strain NBRC 12016)
Q92H91 4.21e-07 54 26 5 163 3 plp Parvulin-like PPIase Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q92H91 0.000396 45 23 7 215 3 plp Parvulin-like PPIase Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q5HN96 4.66e-07 55 33 1 100 3 prsA Foldase protein PrsA Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
B1YK87 5.54e-07 54 31 4 106 3 prsA Foldase protein PrsA Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
B1YK87 1.52e-05 50 29 5 113 3 prsA Foldase protein PrsA Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
P23119 9.02e-07 53 31 2 101 3 nifM Putative peptidyl-prolyl cis-trans isomerase NifM Azotobacter chroococcum mcd 1
B1KTE0 9.89e-07 53 23 11 293 3 prsA Foldase protein PrsA Clostridium botulinum (strain Loch Maree / Type A3)
B1KTE0 2.58e-06 52 33 6 112 3 prsA Foldase protein PrsA Clostridium botulinum (strain Loch Maree / Type A3)
Q97E99 1.19e-06 53 33 7 133 3 prsA Foldase protein PrsA Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q97E99 0.00013 47 21 8 216 3 prsA Foldase protein PrsA Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q9KDN4 1.62e-06 53 27 3 105 3 prsA Foldase protein PrsA Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q9KDN4 0.00011 47 27 2 109 3 prsA Foldase protein PrsA Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
O74448 1.66e-06 51 32 4 125 4 pin1 Peptidyl-prolyl cis-trans isomerase pin1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q94G00 1.73e-06 50 33 2 112 2 PIN1 Peptidyl-prolyl cis-trans isomerase Pin1 Malus domestica
Q8R760 2.52e-06 52 32 3 97 3 prsA Foldase protein PrsA Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q8R760 4.96e-06 51 21 12 293 3 prsA Foldase protein PrsA Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
P0A9L5 3.2e-06 48 32 1 76 1 ppiC Peptidyl-prolyl cis-trans isomerase C Escherichia coli (strain K12)
P0A9L6 3.2e-06 48 32 1 76 3 ppiC Peptidyl-prolyl cis-trans isomerase C Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9L7 3.2e-06 48 32 1 76 3 ppiC Peptidyl-prolyl cis-trans isomerase C Escherichia coli O157:H7
Q68WG0 5.03e-06 51 27 4 123 3 plp Parvulin-like PPIase Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q4UKY0 6.08e-06 51 26 5 163 3 plp Parvulin-like PPIase Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
P0A3Y9 8.97e-06 50 27 3 122 3 nifM Putative peptidyl-prolyl cis-trans isomerase NifM Klebsiella pneumoniae
P0A3Z0 8.97e-06 50 27 3 122 3 nifM Putative peptidyl-prolyl cis-trans isomerase NifM Klebsiella oxytoca
Q1RI35 9.77e-06 50 25 5 160 3 plp Parvulin-like PPIase Rickettsia bellii (strain RML369-C)
Q1RI35 0.000317 46 26 5 143 3 plp Parvulin-like PPIase Rickettsia bellii (strain RML369-C)
P0C1J8 1.44e-05 48 33 3 106 3 pin1 Peptidyl-prolyl cis-trans isomerase pin1 Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880)
P14890 1.57e-05 50 30 2 96 3 nifM Putative peptidyl-prolyl cis-trans isomerase NifM Azotobacter vinelandii
P14890 0.001 44 25 4 117 3 nifM Putative peptidyl-prolyl cis-trans isomerase NifM Azotobacter vinelandii
Q503Y7 3.31e-05 46 31 4 108 2 pin4 Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4 Danio rerio
Q4I665 3.64e-05 46 31 5 101 3 PIN4 Peptidyl-prolyl cis-trans isomerase PIN4 Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
Q6P4K8 5.46e-05 46 31 4 109 2 pin4 Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4 Xenopus tropicalis
P0A265 5.76e-05 45 31 2 88 3 ppiC Peptidyl-prolyl cis-trans isomerase C Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A266 5.76e-05 45 31 2 88 3 ppiC Peptidyl-prolyl cis-trans isomerase C Salmonella typhi
Q9Y237 5.79e-05 46 30 4 106 1 PIN4 Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4 Homo sapiens
Q9CWW6 6.02e-05 46 31 4 103 1 Pin4 Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4 Mus musculus
A6QPY8 6.95e-05 45 31 4 106 2 PIN4 Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4 Bos taurus
P22696 8.43e-05 46 35 3 109 1 ESS1 Peptidyl-prolyl cis-trans isomerase ESS1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q0SQ68 0.000108 47 27 2 99 3 prsA Foldase protein PrsA Clostridium perfringens (strain SM101 / Type A)
Q4WJM6 0.000123 45 29 4 103 3 pin4 Peptidyl-prolyl cis-trans isomerase pin4 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
P44092 0.000138 47 21 13 405 3 ppiD Periplasmic chaperone PpiD Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q7VKX4 0.000139 47 24 10 320 3 ppiD Periplasmic chaperone PpiD Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q5BIN5 0.000156 45 33 5 117 2 PIN1 Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 Bos taurus
B5KFL3 0.000158 44 28 4 108 2 PIN4 Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4 Taeniopygia guttata
Q9QUR7 0.000404 44 33 6 117 1 Pin1 Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 Mus musculus
Q4R383 0.000654 43 33 4 107 2 PIN1 Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 Macaca fascicularis
Q13526 0.00066 43 33 4 107 1 PIN1 Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 Homo sapiens
Q7RYY4 0.00081 42 27 4 104 3 ppi-5 Peptidyl-prolyl cis-trans isomerase pin4 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS15665
Feature type CDS
Gene surA
Product peptidylprolyl isomerase SurA
Location 128566 - 129864 (strand: -1)
Length 1299 (nucleotides) / 432 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000005
Length 213534 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1162
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00639 PPIC-type PPIASE domain
PF09312 SurA N-terminal domain
PF13616 PPIC-type PPIASE domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0760 Posttranslational modification, protein turnover, chaperones (O) O Peptidyl-prolyl isomerase, parvulin family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03771 peptidyl-prolyl cis-trans isomerase SurA [EC:5.2.1.8] - -

Protein Sequence

MKNWRTLILGLMFTASTTAFAAPQQMDKVAAVVNNGVVLESDVNNMLQTVVVNAKNAGQQVPDQATLRQQILERLIMDNIVMQMAGQMQITIPEQAIDGAIEDIARQNNISSAQMKERLKRDGMSYDKYRSEIRKEMMMAEVRNNEVRRRVVILPQEVDALANLISAQNSADSELNISHILIPMPENPTDAQMNAAKEKVSVIMSELQKGADFGKLAITYSADPQALKGGNMGWSRLQELPGLFVERLQSAKKGEIVGPVRSGVGFHILRVNDMRGNSQPISVTEVKARHILIKPSPIMTDEQARSKLQQITNDVKSGKTSFEDAAKQFSEDPGSALRGGELGWSMPDVYDPAFRDALMKLKKGDLSQPVRSSFGWHLIQLEDTRNVDKTEAAQKDRAYRMLFNRKFSEELQSWMQEQRAGAYVEILDGSNK

Flanking regions ( +/- flanking 50bp)

TTTCACCTGCCGTGCGATAGCACGGCTACTCGAAACATGATGGGATATATATGAAAAACTGGAGAACACTCATTCTCGGCCTGATGTTCACGGCAAGCACTACCGCGTTTGCCGCACCGCAGCAGATGGACAAAGTTGCCGCTGTGGTGAATAACGGCGTTGTTCTGGAGAGTGATGTAAACAATATGCTTCAGACTGTTGTCGTCAATGCCAAAAATGCCGGTCAGCAGGTTCCGGATCAGGCAACTCTGCGTCAGCAAATTCTTGAACGCCTCATCATGGATAATATCGTGATGCAGATGGCAGGACAGATGCAGATAACCATCCCGGAACAGGCTATTGATGGTGCAATTGAAGATATCGCCCGTCAGAACAACATCTCTTCCGCTCAGATGAAAGAACGTCTGAAACGTGATGGCATGAGCTATGACAAATACCGCAGTGAAATCCGCAAAGAGATGATGATGGCGGAAGTGCGTAATAACGAAGTACGCCGCCGTGTGGTCATTTTACCGCAGGAAGTCGATGCGTTAGCGAACCTCATCAGTGCACAGAACTCCGCAGATTCTGAGCTGAATATCAGCCATATTCTGATCCCGATGCCGGAAAATCCGACAGATGCACAGATGAATGCCGCCAAAGAAAAAGTCTCTGTGATTATGAGCGAACTGCAGAAAGGTGCTGATTTCGGCAAACTGGCTATCACCTATTCCGCTGATCCTCAGGCACTGAAAGGCGGTAACATGGGCTGGAGCCGTTTACAGGAACTGCCGGGTCTGTTTGTTGAGCGCCTGCAATCGGCTAAAAAAGGTGAGATTGTCGGTCCTGTCCGCTCCGGTGTCGGCTTCCATATTCTGCGCGTGAATGATATGCGCGGAAACAGTCAGCCAATTTCGGTGACTGAAGTTAAAGCCCGTCACATTCTGATCAAACCATCACCGATCATGACGGATGAACAGGCACGCAGCAAATTACAGCAGATAACCAATGATGTAAAAAGCGGCAAAACATCCTTTGAGGATGCGGCAAAACAATTCTCTGAAGATCCGGGCTCTGCCCTGCGTGGTGGTGAGTTAGGCTGGTCAATGCCTGATGTTTACGACCCGGCTTTCCGTGACGCATTAATGAAACTGAAAAAAGGCGACCTGAGTCAGCCTGTCCGTTCCTCTTTCGGCTGGCACCTTATCCAGTTGGAAGATACCCGCAATGTGGACAAAACCGAAGCGGCTCAGAAAGATCGTGCCTACCGGATGCTGTTTAACCGCAAATTCAGCGAAGAGTTACAGAGCTGGATGCAGGAACAGCGCGCTGGCGCTTATGTGGAAATTTTAGATGGCAGTAACAAATAGTCTGAAACCCGTTGTTATTACCCCCGGCGAACCTGCCGGGGTGGGTCCTG