Homologs in group_1099

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_06255 FBDBKF_06255 100.0 Morganella morganii S1 surA peptidylprolyl isomerase SurA
NLDBIP_09680 NLDBIP_09680 100.0 Morganella morganii S4 surA peptidylprolyl isomerase SurA
LHKJJB_08075 LHKJJB_08075 100.0 Morganella morganii S3 surA peptidylprolyl isomerase SurA
HKOGLL_07625 HKOGLL_07625 100.0 Morganella morganii S5 surA peptidylprolyl isomerase SurA
F4V73_RS15665 F4V73_RS15665 91.2 Morganella psychrotolerans surA peptidylprolyl isomerase SurA
PMI_RS11535 PMI_RS11535 68.2 Proteus mirabilis HI4320 surA peptidylprolyl isomerase SurA

Distribution of the homologs in the orthogroup group_1099

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1099

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7N8V5 0.0 673 73 1 431 3 surA Chaperone SurA Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q66EQ7 0.0 635 70 1 431 3 surA Chaperone SurA Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1CMT0 0.0 635 70 1 431 3 surA Chaperone SurA Yersinia pestis bv. Antiqua (strain Nepal516)
Q7CG87 0.0 635 70 1 431 3 surA Chaperone SurA Yersinia pestis
Q1C0H3 0.0 632 70 1 431 3 surA Chaperone SurA Yersinia pestis bv. Antiqua (strain Antiqua)
Q57TG8 0.0 627 68 1 427 3 surA Chaperone SurA Salmonella choleraesuis (strain SC-B67)
Q7CR87 0.0 607 69 1 427 3 surA Chaperone SurA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XEV3 0.0 607 69 1 427 3 surA Chaperone SurA Salmonella typhi
Q5PDE6 0.0 607 69 1 427 3 surA Chaperone SurA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q3Z5V6 0.0 602 68 1 427 3 surA Chaperone SurA Shigella sonnei (strain Ss046)
P0ABZ9 0.0 602 68 1 427 3 surA Chaperone SurA Shigella flexneri
Q326I0 0.0 602 68 1 427 3 surA Chaperone SurA Shigella boydii serotype 4 (strain Sb227)
Q1RGE4 0.0 602 68 1 427 3 surA Chaperone SurA Escherichia coli (strain UTI89 / UPEC)
P0ABZ6 0.0 602 68 1 427 1 surA Chaperone SurA Escherichia coli (strain K12)
P0ABZ7 0.0 602 68 1 427 3 surA Chaperone SurA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ABZ8 0.0 602 68 1 427 1 surA Chaperone SurA Escherichia coli O157:H7
Q32K41 0.0 599 68 1 427 3 surA Chaperone SurA Shigella dysenteriae serotype 1 (strain Sd197)
Q6D0E2 0.0 587 64 1 430 3 surA Chaperone SurA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q2NVX4 0.0 578 65 1 432 3 surA Chaperone SurA Sodalis glossinidius (strain morsitans)
Q6LV39 6.37e-146 425 45 3 432 3 surA Chaperone SurA Photobacterium profundum (strain SS9)
Q0HLT0 6.75e-138 405 43 2 428 3 surA Chaperone SurA Shewanella sp. (strain MR-4)
Q8EB95 1.01e-137 404 43 2 428 3 surA Chaperone SurA Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q0HS08 1.31e-137 404 43 2 428 3 surA Chaperone SurA Shewanella sp. (strain MR-7)
Q7MP84 8.31e-137 402 44 4 429 3 surA Chaperone SurA Vibrio vulnificus (strain YJ016)
Q8DED4 2.17e-136 400 44 4 429 3 surA Chaperone SurA Vibrio vulnificus (strain CMCP6)
Q07YK0 7.85e-136 399 43 2 433 3 surA Chaperone SurA Shewanella frigidimarina (strain NCIMB 400)
Q5E863 1.8e-135 399 46 2 428 3 surA Chaperone SurA Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q87ST4 1.64e-132 391 41 3 431 3 surA Chaperone SurA Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q15QB3 8.67e-132 389 43 1 423 3 surA Chaperone SurA Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q12K61 1.01e-131 389 41 2 429 3 surA Chaperone SurA Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q47VK0 2.24e-130 385 43 2 422 3 surA Chaperone SurA Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q9KUS0 2.37e-129 383 42 3 428 3 surA Chaperone SurA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q3IFD3 2.41e-125 373 42 1 417 3 surA Chaperone SurA Pseudoalteromonas translucida (strain TAC 125)
Q1QZ33 1.05e-103 317 40 6 425 3 surA Chaperone SurA Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q1LSS0 1.09e-101 312 38 5 419 3 surA Chaperone SurA Baumannia cicadellinicola subsp. Homalodisca coagulata
Q5QVN9 2.3e-101 311 39 3 390 3 surA Chaperone SurA Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q3K5T4 9.93e-97 299 38 6 427 3 surA Chaperone SurA Pseudomonas fluorescens (strain Pf0-1)
Q21MS8 3.56e-96 298 35 3 418 3 surA Chaperone SurA Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q3JAF1 5.71e-96 297 36 2 421 3 surA Chaperone SurA Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q4K4X7 6.4e-95 295 37 5 420 3 surA Chaperone SurA Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q88QT4 1.03e-94 294 37 3 426 3 surA Chaperone SurA Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q5WZN0 5.04e-94 292 36 3 425 3 surA Chaperone SurA Legionella pneumophila (strain Lens)
Q5ZYR3 1.78e-93 291 35 3 425 3 surA Chaperone SurA Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q0VMV4 1.85e-93 291 35 2 423 3 surA Chaperone SurA Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q9I5U3 1.89e-93 290 38 3 417 3 surA Chaperone SurA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q5X877 3.09e-93 290 36 5 426 3 surA Chaperone SurA Legionella pneumophila (strain Paris)
Q1GZC0 9.37e-93 289 37 3 422 3 surA Chaperone SurA Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q88A44 3.14e-92 288 37 5 422 3 surA Chaperone SurA Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q48NT5 1.26e-89 281 36 5 422 3 surA Chaperone SurA Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q4ZMG7 3.49e-89 280 36 3 420 3 surA Chaperone SurA Pseudomonas syringae pv. syringae (strain B728a)
Q60B78 1.68e-88 279 35 3 417 3 surA Chaperone SurA Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q0AC82 9.84e-83 263 34 6 409 3 surA Chaperone SurA Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q3SGF9 1.07e-82 263 36 3 401 3 surA Chaperone SurA Thiobacillus denitrificans (strain ATCC 25259)
Q8Y220 3.79e-81 261 36 8 428 3 surA Chaperone SurA Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q2S9C1 4.97e-81 259 34 2 406 3 surA Chaperone SurA Hahella chejuensis (strain KCTC 2396)
Q5P7I9 3.9e-79 254 34 7 433 3 surA Chaperone SurA Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q479U4 5.29e-79 254 36 5 409 3 surA Chaperone SurA Dechloromonas aromatica (strain RCB)
Q2NZI6 7.17e-78 252 33 5 426 3 surA Chaperone SurA Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q5GWC1 1.15e-77 251 33 5 426 3 surA Chaperone SurA Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q82W17 1.5e-77 250 33 3 421 3 surA Chaperone SurA Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q3BX80 1.86e-77 251 33 5 426 3 surA Chaperone SurA Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q121Q4 9.59e-77 249 35 3 404 3 surA Chaperone SurA Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q8PP23 1.41e-76 248 32 5 426 3 surA Chaperone SurA Xanthomonas axonopodis pv. citri (strain 306)
Q2KXA6 4.63e-76 248 32 5 451 3 surA Chaperone SurA Bordetella avium (strain 197N)
Q8PCE1 2.77e-75 245 32 7 437 3 surA Chaperone SurA Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UR41 2.77e-75 245 32 7 437 3 surA Chaperone SurA Xanthomonas campestris pv. campestris (strain 8004)
Q2YBP3 7.9e-74 241 33 4 421 3 surA Chaperone SurA Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q1LRA3 1.17e-73 242 33 7 423 3 surA Chaperone SurA Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q7NQB0 2.54e-73 239 33 9 432 3 surA Chaperone SurA Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q7WG19 6.51e-73 241 31 3 462 3 surA Chaperone SurA Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q7VU12 2.45e-72 239 31 3 462 3 surA Chaperone SurA Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W4J5 3.44e-72 239 31 3 462 3 surA Chaperone SurA Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q8KA01 1.4e-71 234 27 5 433 3 surA Chaperone SurA Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q475Q3 5.86e-71 235 34 6 416 3 surA Chaperone SurA Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q87AJ0 8.91e-71 233 31 6 438 3 surA Chaperone SurA Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q9PF40 1.09e-69 231 30 6 439 3 surA Chaperone SurA Xylella fastidiosa (strain 9a5c)
Q223E5 1.03e-68 228 33 4 404 3 surA Chaperone SurA Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
P57240 3.39e-67 223 29 4 412 3 surA Chaperone SurA Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q145L3 2.16e-66 221 33 9 424 3 surA Chaperone SurA Paraburkholderia xenovorans (strain LB400)
Q39D35 2.37e-55 192 31 9 412 3 surA Chaperone SurA Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q493R5 2.87e-55 192 27 7 433 3 surA Chaperone SurA Blochmanniella pennsylvanica (strain BPEN)
Q1BTQ6 3.89e-55 192 31 10 413 3 surA Chaperone SurA Burkholderia orbicola (strain AU 1054)
Q31F26 4.18e-55 192 28 10 438 3 surA Chaperone SurA Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q3JVW8 3.79e-54 189 30 10 413 3 surA Chaperone SurA Burkholderia pseudomallei (strain 1710b)
Q63X78 4.08e-54 189 30 10 413 3 surA Chaperone SurA Burkholderia pseudomallei (strain K96243)
Q62MM4 6.54e-54 189 30 10 413 3 surA Chaperone SurA Burkholderia mallei (strain ATCC 23344)
Q2T116 1.5e-53 188 30 9 410 3 surA Chaperone SurA Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
P44721 1.28e-28 117 33 0 154 3 surA Putative peptidyl-prolyl cis-trans isomerase SurA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P44721 3.96e-19 90 27 8 281 3 surA Putative peptidyl-prolyl cis-trans isomerase SurA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q7WCX5 5.14e-21 95 46 2 105 3 BB3803 Probable parvulin-type peptidyl-prolyl cis-trans isomerase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q7WCX5 7.76e-05 47 22 9 248 3 BB3803 Probable parvulin-type peptidyl-prolyl cis-trans isomerase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
P40415 8.98e-21 94 46 2 105 2 BP3561 Probable parvulin-type peptidyl-prolyl cis-trans isomerase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
P40415 7.41e-05 47 23 9 248 2 BP3561 Probable parvulin-type peptidyl-prolyl cis-trans isomerase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W5E0 8.98e-21 94 46 2 105 3 BPP3352 Probable parvulin-type peptidyl-prolyl cis-trans isomerase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7W5E0 7.41e-05 47 23 9 248 3 BPP3352 Probable parvulin-type peptidyl-prolyl cis-trans isomerase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q81GY5 1.13e-16 83 40 4 114 3 prsA1 Foldase protein PrsA 1 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q81GY5 1.06e-05 50 23 9 211 3 prsA1 Foldase protein PrsA 1 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q81U45 1.44e-16 83 39 4 119 1 prsA1 Foldase protein PrsA 1 Bacillus anthracis
Q81U45 4.36e-06 51 23 9 211 1 prsA1 Foldase protein PrsA 1 Bacillus anthracis
Q81CB1 6.25e-15 78 43 3 98 1 prsA4 Foldase protein PrsA 4 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q81CB1 1.23e-06 53 22 15 280 1 prsA4 Foldase protein PrsA 4 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q5L289 2.37e-14 76 29 6 199 3 prsA Foldase protein PrsA Geobacillus kaustophilus (strain HTA426)
Q5L289 6.05e-08 57 32 2 97 3 prsA Foldase protein PrsA Geobacillus kaustophilus (strain HTA426)
P60749 2.98e-14 76 31 2 158 3 prsA Foldase protein PrsA Staphylococcus aureus (strain MW2)
P60749 4.34e-06 52 22 7 239 3 prsA Foldase protein PrsA Staphylococcus aureus (strain MW2)
A8YY10 2.98e-14 76 31 2 158 3 prsA Foldase protein PrsA Staphylococcus aureus (strain USA300 / TCH1516)
A8YY10 4.34e-06 52 22 7 239 3 prsA Foldase protein PrsA Staphylococcus aureus (strain USA300 / TCH1516)
Q6G894 2.98e-14 76 31 2 158 3 prsA Foldase protein PrsA Staphylococcus aureus (strain MSSA476)
Q6G894 4.34e-06 52 22 7 239 3 prsA Foldase protein PrsA Staphylococcus aureus (strain MSSA476)
P60748 2.98e-14 76 31 2 158 1 prsA Foldase protein PrsA Staphylococcus aureus (strain N315)
P60748 4.34e-06 52 22 7 239 1 prsA Foldase protein PrsA Staphylococcus aureus (strain N315)
P60747 2.98e-14 76 31 2 158 1 prsA Foldase protein PrsA Staphylococcus aureus (strain Mu50 / ATCC 700699)
P60747 4.34e-06 52 22 7 239 1 prsA Foldase protein PrsA Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QI23 2.98e-14 76 31 2 158 3 prsA Foldase protein PrsA Staphylococcus aureus (strain Newman)
A6QI23 4.34e-06 52 22 7 239 3 prsA Foldase protein PrsA Staphylococcus aureus (strain Newman)
Q5HET4 2.98e-14 76 31 2 158 3 prsA Foldase protein PrsA Staphylococcus aureus (strain COL)
Q5HET4 4.34e-06 52 22 7 239 3 prsA Foldase protein PrsA Staphylococcus aureus (strain COL)
Q2G2S6 2.98e-14 76 31 2 158 3 prsA Foldase protein PrsA Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2G2S6 4.34e-06 52 22 7 239 3 prsA Foldase protein PrsA Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FFQ5 2.98e-14 76 31 2 158 3 prsA Foldase protein PrsA Staphylococcus aureus (strain USA300)
Q2FFQ5 4.34e-06 52 22 7 239 3 prsA Foldase protein PrsA Staphylococcus aureus (strain USA300)
A6U2U4 2.98e-14 76 31 2 158 3 prsA Foldase protein PrsA Staphylococcus aureus (strain JH1)
A6U2U4 4.34e-06 52 22 7 239 3 prsA Foldase protein PrsA Staphylococcus aureus (strain JH1)
A7X3U8 2.98e-14 76 31 2 158 3 prsA Foldase protein PrsA Staphylococcus aureus (strain Mu3 / ATCC 700698)
A7X3U8 4.34e-06 52 22 7 239 3 prsA Foldase protein PrsA Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q2YTZ6 5.82e-14 75 31 2 158 3 prsA Foldase protein PrsA Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2YTZ6 2.9e-06 52 22 7 239 3 prsA Foldase protein PrsA Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q6GFL5 5.87e-14 75 31 2 158 3 prsA Foldase protein PrsA Staphylococcus aureus (strain MRSA252)
Q6GFL5 7.67e-07 54 23 7 239 3 prsA Foldase protein PrsA Staphylococcus aureus (strain MRSA252)
C5D6L9 1.14e-13 74 38 2 98 3 prsA Foldase protein PrsA Geobacillus sp. (strain WCH70)
C5D6L9 2.25e-07 55 34 3 97 3 prsA Foldase protein PrsA Geobacillus sp. (strain WCH70)
A4IKU2 2.34e-12 70 31 7 154 3 prsA Foldase protein PrsA Geobacillus thermodenitrificans (strain NG80-2)
A4IKU2 9.02e-09 59 35 3 97 3 prsA Foldase protein PrsA Geobacillus thermodenitrificans (strain NG80-2)
Q81QT1 1.85e-11 68 33 4 115 1 prsA3 Foldase protein PrsA 3 Bacillus anthracis
Q8CXK4 2.03e-11 68 30 3 126 3 prsA Foldase protein PrsA Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q8CXK4 5.93e-09 60 34 3 111 3 prsA Foldase protein PrsA Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q81DT1 7.27e-11 66 33 4 115 3 prsA3 Foldase protein PrsA 3 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q81GN0 8.16e-10 63 35 4 113 3 prsA2 Foldase protein PrsA 2 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q81GN0 0.000342 45 23 10 218 3 prsA2 Foldase protein PrsA 2 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
A5I7R3 8.46e-10 63 39 4 94 3 prsA Foldase protein PrsA Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A5I7R3 5.19e-08 58 26 10 218 3 prsA Foldase protein PrsA Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FPK5 8.46e-10 63 39 4 94 3 prsA Foldase protein PrsA Clostridium botulinum (strain ATCC 19397 / Type A)
A7FPK5 5.19e-08 58 26 10 218 3 prsA Foldase protein PrsA Clostridium botulinum (strain ATCC 19397 / Type A)
Q899I2 1.24e-09 63 32 7 146 3 prsA Foldase protein PrsA Clostridium tetani (strain Massachusetts / E88)
Q899I2 3.67e-06 52 24 11 236 3 prsA Foldase protein PrsA Clostridium tetani (strain Massachusetts / E88)
A7GJD2 1.28e-09 62 39 4 94 3 prsA Foldase protein PrsA Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
A7GJD2 3.62e-08 58 25 15 296 3 prsA Foldase protein PrsA Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
C3KW94 1.31e-09 62 29 6 145 3 prsA Foldase protein PrsA Clostridium botulinum (strain 657 / Type Ba4)
C3KW94 1.78e-05 50 23 8 216 3 prsA Foldase protein PrsA Clostridium botulinum (strain 657 / Type Ba4)
C1FNE4 5.31e-09 61 38 4 94 3 prsA Foldase protein PrsA Clostridium botulinum (strain Kyoto / Type A2)
C1FNE4 5.03e-07 55 25 10 218 3 prsA Foldase protein PrsA Clostridium botulinum (strain Kyoto / Type A2)
B1IGZ5 5.65e-09 60 38 4 94 3 prsA Foldase protein PrsA Clostridium botulinum (strain Okra / Type B1)
B1IGZ5 5.4e-07 55 25 10 218 3 prsA Foldase protein PrsA Clostridium botulinum (strain Okra / Type B1)
Q81TU1 7.13e-09 60 33 4 115 1 prsA2 Foldase protein PrsA 2 Bacillus anthracis
A5N4J2 7.88e-09 60 23 17 306 3 prsA Foldase protein PrsA Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
A5N4J2 2.74e-07 55 36 4 94 3 prsA Foldase protein PrsA Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9DY54 7.88e-09 60 23 17 306 3 prsA Foldase protein PrsA Clostridium kluyveri (strain NBRC 12016)
B9DY54 2.74e-07 55 36 4 94 3 prsA Foldase protein PrsA Clostridium kluyveri (strain NBRC 12016)
P24327 9.65e-09 60 29 2 104 1 prsA Foldase protein PrsA Bacillus subtilis (strain 168)
P24327 1.5e-08 59 32 4 101 1 prsA Foldase protein PrsA Bacillus subtilis (strain 168)
Q8CNR4 3.1e-08 58 32 1 118 3 prsA Foldase protein PrsA Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q0PAS1 3.33e-08 58 35 3 102 1 cbf2 Putative peptidyl-prolyl cis-trans isomerase Cbf2 Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A1VYV6 3.97e-08 57 35 3 102 3 cbf2 Putative peptidyl-prolyl cis-trans isomerase Cbf2 Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q5HN96 1.07e-07 57 31 1 118 3 prsA Foldase protein PrsA Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
B1KTE0 1.83e-07 56 34 6 112 3 prsA Foldase protein PrsA Clostridium botulinum (strain Loch Maree / Type A3)
B1KTE0 2.38e-06 52 23 7 215 3 prsA Foldase protein PrsA Clostridium botulinum (strain Loch Maree / Type A3)
B1YK87 2.59e-07 55 30 5 118 3 prsA Foldase protein PrsA Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
B1YK87 5.16e-05 48 23 12 273 3 prsA Foldase protein PrsA Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
Q97E99 2.72e-07 55 35 7 126 3 prsA Foldase protein PrsA Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q8R760 2.92e-07 55 32 2 97 3 prsA Foldase protein PrsA Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q8R760 0.001 44 21 15 347 3 prsA Foldase protein PrsA Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q71XE6 3.85e-07 55 25 5 183 3 prsA2 Foldase protein PrsA 2 Listeria monocytogenes serotype 4b (strain F2365)
Q9ZCX6 4.03e-07 55 28 6 160 3 plp Parvulin-like PPIase Rickettsia prowazekii (strain Madrid E)
Q9ZCX6 0.001 44 24 5 145 3 plp Parvulin-like PPIase Rickettsia prowazekii (strain Madrid E)
Q8Y557 5.63e-07 54 28 3 137 3 prsA2 Foldase protein PrsA 2 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q92BR2 1.03e-06 53 36 5 107 3 prsA1 Foldase protein PrsA 1 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q92H91 1.06e-06 53 28 4 149 3 plp Parvulin-like PPIase Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q94G00 1.51e-06 50 34 2 112 2 PIN1 Peptidyl-prolyl cis-trans isomerase Pin1 Malus domestica
Q929F4 1.77e-06 53 25 9 202 3 prsA2 Foldase protein PrsA 2 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
P0C1J8 1.79e-06 50 35 3 106 3 pin1 Peptidyl-prolyl cis-trans isomerase pin1 Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880)
P0C1J8 0.000167 45 28 2 102 3 pin1 Peptidyl-prolyl cis-trans isomerase pin1 Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880)
Q9KDN4 2.87e-06 52 28 2 105 3 prsA Foldase protein PrsA Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q9KDN4 0.000222 46 27 2 109 3 prsA Foldase protein PrsA Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q68WG0 3.66e-06 52 29 5 120 3 plp Parvulin-like PPIase Rickettsia typhi (strain ATCC VR-144 / Wilmington)
P0A9L5 5.93e-06 47 31 0 69 1 ppiC Peptidyl-prolyl cis-trans isomerase C Escherichia coli (strain K12)
P0A9L6 5.93e-06 47 31 0 69 3 ppiC Peptidyl-prolyl cis-trans isomerase C Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9L7 5.93e-06 47 31 0 69 3 ppiC Peptidyl-prolyl cis-trans isomerase C Escherichia coli O157:H7
Q1RI35 6.44e-06 51 28 5 146 3 plp Parvulin-like PPIase Rickettsia bellii (strain RML369-C)
Q1RI35 0.000328 45 27 6 145 3 plp Parvulin-like PPIase Rickettsia bellii (strain RML369-C)
Q9ZMQ7 6.68e-06 51 31 5 147 3 jhp_0161 Putative peptidyl-prolyl cis-trans isomerase jhp_0161 Helicobacter pylori (strain J99 / ATCC 700824)
P23119 6.84e-06 51 30 2 101 3 nifM Putative peptidyl-prolyl cis-trans isomerase NifM Azotobacter chroococcum mcd 1
P56112 7.12e-06 51 31 5 147 1 HP_0175 Putative peptidyl-prolyl cis-trans isomerase HP_0175 Helicobacter pylori (strain ATCC 700392 / 26695)
Q4UKY0 1.05e-05 50 26 4 146 3 plp Parvulin-like PPIase Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q7RYY4 1.47e-05 47 29 4 104 3 ppi-5 Peptidyl-prolyl cis-trans isomerase pin4 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
O74448 1.47e-05 48 33 5 126 4 pin1 Peptidyl-prolyl cis-trans isomerase pin1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P0A3Y9 1.48e-05 50 28 3 125 3 nifM Putative peptidyl-prolyl cis-trans isomerase NifM Klebsiella pneumoniae
P0A3Z0 1.48e-05 50 28 3 125 3 nifM Putative peptidyl-prolyl cis-trans isomerase NifM Klebsiella oxytoca
Q4I665 1.65e-05 47 29 4 101 3 PIN4 Peptidyl-prolyl cis-trans isomerase PIN4 Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
P0ADY1 1.66e-05 50 28 6 157 1 ppiD Periplasmic chaperone PpiD Escherichia coli (strain K12)
P0ADY2 1.66e-05 50 28 6 157 3 ppiD Periplasmic chaperone PpiD Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P22696 2.22e-05 48 39 2 79 1 ESS1 Peptidyl-prolyl cis-trans isomerase ESS1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q7VKX4 5.54e-05 49 34 1 79 3 ppiD Periplasmic chaperone PpiD Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q7VKX4 7.92e-05 48 24 4 148 3 ppiD Periplasmic chaperone PpiD Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q503Y7 6.88e-05 45 31 4 108 2 pin4 Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4 Danio rerio
P14890 7.6e-05 48 29 2 98 3 nifM Putative peptidyl-prolyl cis-trans isomerase NifM Azotobacter vinelandii
P14890 0.000233 46 25 6 164 3 nifM Putative peptidyl-prolyl cis-trans isomerase NifM Azotobacter vinelandii
Q6P4K8 0.000138 45 31 4 109 2 pin4 Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4 Xenopus tropicalis
P0A265 0.000164 43 30 0 69 3 ppiC Peptidyl-prolyl cis-trans isomerase C Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A266 0.000164 43 30 0 69 3 ppiC Peptidyl-prolyl cis-trans isomerase C Salmonella typhi
Q5BIN5 0.00022 45 33 6 117 2 PIN1 Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 Bos taurus
P44092 0.000393 46 21 15 453 3 ppiD Periplasmic chaperone PpiD Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q4WJM6 0.000417 43 29 4 103 3 pin4 Peptidyl-prolyl cis-trans isomerase pin4 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q9QUR7 0.000461 44 33 6 117 1 Pin1 Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 Mus musculus
A6QPY8 0.00054 43 32 4 103 2 PIN4 Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4 Bos taurus
Q9Y237 0.000687 43 31 4 103 1 PIN4 Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4 Homo sapiens
Q4R383 0.000894 43 33 5 107 2 PIN1 Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 Macaca fascicularis
Q13526 0.001 43 33 5 107 1 PIN1 Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 Homo sapiens

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_09300
Feature type CDS
Gene surA
Product peptidylprolyl isomerase SurA
Location 84797 - 86095 (strand: 1)
Length 1299 (nucleotides) / 432 (amino acids)

Contig

Accession ZDB_218
Length 215957 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1099
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00639 PPIC-type PPIASE domain
PF09312 SurA N-terminal domain
PF13616 PPIC-type PPIASE domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0760 Posttranslational modification, protein turnover, chaperones (O) O Peptidyl-prolyl isomerase, parvulin family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03771 peptidyl-prolyl cis-trans isomerase SurA [EC:5.2.1.8] - -

Protein Sequence

MKNWRTLILGLMFTASTTSFAAPQQLDKVAAVVNNGVVLESDVNNMLQTVTMNARNAGQQIPDQATLRQQILERLIMDNIVMQMAGQMQISIPDQAVDGAIEDIARQNNMTLAQMKDRLKRDGMSYDKYRSDIRKEMMMAEVRNNEVRRRVVILPQEVDSLANLISTQNAADTELNISHILIPLPENPTEEQMNAAKEKVTTIMNELQHGADFGKLAITYSADPQALKGGNMGWSRLQELPGLFAERLQTAKSGEIVGPVRSGVGFHILRVNEVRGNSQPISVTEVKARHILIKPSPVMTDDQARSKLQQIAADVKSGKTSFDAAAKQFSEDPGSALRGGELGWSMPDIYDPAFRDALMKLKKGELSQPVRSSFGWHLIQLEDTRNVDKTEAAQKDRAYRMLFNRKFSEELQSWMQEQRAGAYVEILDGSNK

Flanking regions ( +/- flanking 50bp)

TTCACATGCCGTACCGGCGGTACGGCGATACGAAACATGATGGGATACTTATGAAAAACTGGAGAACACTCATTCTCGGCCTGATGTTCACGGCAAGCACAACCTCATTCGCAGCACCGCAGCAGCTTGATAAAGTTGCGGCAGTCGTGAATAACGGTGTGGTTCTGGAGAGTGATGTCAATAATATGCTTCAGACTGTCACCATGAATGCCCGCAATGCCGGTCAGCAGATTCCGGATCAGGCAACATTACGTCAGCAGATTCTTGAACGTCTTATCATGGACAATATCGTGATGCAGATGGCCGGACAGATGCAGATCTCTATCCCTGACCAGGCGGTTGACGGCGCTATCGAAGATATCGCCCGTCAGAACAACATGACCCTTGCCCAGATGAAAGATCGTCTGAAACGCGACGGCATGAGCTATGACAAATACCGCAGCGATATCCGCAAAGAAATGATGATGGCGGAAGTCCGTAACAACGAAGTCCGCCGCCGTGTGGTGATCCTGCCGCAGGAAGTTGATTCTCTGGCAAACCTTATCAGCACGCAAAACGCTGCGGATACTGAACTGAACATCAGCCACATCCTGATCCCGCTGCCGGAAAACCCGACAGAAGAGCAGATGAATGCAGCAAAAGAAAAAGTCACCACCATTATGAATGAACTTCAGCATGGTGCCGATTTCGGTAAACTGGCGATCACCTATTCTGCGGATCCGCAGGCGCTGAAAGGCGGTAATATGGGCTGGAGCCGTTTACAGGAGCTGCCGGGTCTGTTTGCCGAGCGCCTTCAGACAGCCAAAAGCGGTGAGATTGTCGGACCGGTACGTTCCGGTGTCGGCTTCCACATTCTGCGCGTGAATGAAGTCCGCGGAAACAGCCAGCCGATTTCTGTGACCGAAGTGAAAGCCCGTCATATTCTGATCAAACCGTCACCGGTGATGACCGATGACCAGGCCCGCAGTAAACTGCAGCAGATTGCCGCTGATGTGAAAAGCGGTAAAACCTCCTTTGATGCTGCGGCAAAACAATTCTCAGAAGATCCGGGCTCTGCCCTGCGTGGTGGTGAGTTAGGCTGGTCAATGCCTGATATCTACGACCCGGCTTTCCGCGACGCACTGATGAAACTGAAAAAAGGCGAACTGAGTCAGCCTGTCCGCTCCTCTTTCGGCTGGCACCTGATCCAGCTTGAAGATACCCGCAACGTGGATAAGACCGAAGCGGCTCAGAAAGATCGCGCTTACCGTATGCTGTTTAACCGTAAATTCAGCGAAGAATTACAGAGCTGGATGCAGGAACAGCGCGCCGGCGCTTACGTGGAAATTTTAGATGGCAGTAACAAATAAGCTGAAACCTGTCGTTATTACCCCCGGCGAACCTGCCGGGGTTGGTCCTG