Homologs in group_1102

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_06270 FBDBKF_06270 91.2 Morganella morganii S1 apaG Co2+/Mg2+ efflux protein ApaG
EHELCC_09315 EHELCC_09315 91.2 Morganella morganii S2 apaG Co2+/Mg2+ efflux protein ApaG
NLDBIP_09695 NLDBIP_09695 91.2 Morganella morganii S4 apaG Co2+/Mg2+ efflux protein ApaG
LHKJJB_08060 LHKJJB_08060 91.2 Morganella morganii S3 apaG Co2+/Mg2+ efflux protein ApaG
HKOGLL_07610 HKOGLL_07610 91.2 Morganella morganii S5 apaG Co2+/Mg2+ efflux protein ApaG
PMI_RS11550 PMI_RS11550 64.0 Proteus mirabilis HI4320 apaG Co2+/Mg2+ efflux protein ApaG

Distribution of the homologs in the orthogroup group_1102

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1102

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
C6DEY7 6.11e-65 196 69 0 125 3 apaG Protein ApaG Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6D0D9 6.24e-65 196 70 0 125 3 apaG Protein ApaG Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A8G9N9 2.66e-64 194 72 0 125 3 apaG Protein ApaG Serratia proteamaculans (strain 568)
B2VGP5 4.8e-63 191 72 0 125 3 apaG Protein ApaG Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A1JJF3 7.05e-63 190 71 0 121 3 apaG Protein ApaG Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A8ALQ0 1.21e-62 190 71 0 125 3 apaG Protein ApaG Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q56017 1.44e-62 189 70 0 125 3 apaG Protein ApaG Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TWT5 1.44e-62 189 70 0 125 3 apaG Protein ApaG Salmonella schwarzengrund (strain CVM19633)
B5BL26 1.44e-62 189 70 0 125 3 apaG Protein ApaG Salmonella paratyphi A (strain AKU_12601)
A9MYM3 1.44e-62 189 70 0 125 3 apaG Protein ApaG Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PDE0 1.44e-62 189 70 0 125 3 apaG Protein ApaG Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T6L5 1.44e-62 189 70 0 125 3 apaG Protein ApaG Salmonella newport (strain SL254)
B4TJ46 1.44e-62 189 70 0 125 3 apaG Protein ApaG Salmonella heidelberg (strain SL476)
B5RGC1 1.44e-62 189 70 0 125 3 apaG Protein ApaG Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R1S7 1.44e-62 189 70 0 125 3 apaG Protein ApaG Salmonella enteritidis PT4 (strain P125109)
B5FI33 1.44e-62 189 70 0 125 3 apaG Protein ApaG Salmonella dublin (strain CT_02021853)
Q57TH1 1.44e-62 189 70 0 125 3 apaG Protein ApaG Salmonella choleraesuis (strain SC-B67)
A9MQG3 1.44e-62 189 70 0 125 3 apaG Protein ApaG Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5F770 1.44e-62 189 70 0 125 3 apaG Protein ApaG Salmonella agona (strain SL483)
Q7N8V8 2.18e-62 189 71 0 125 3 apaG Protein ApaG Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q3Z5V9 4.96e-62 188 69 0 125 3 apaG Protein ApaG Shigella sonnei (strain Ss046)
P62675 4.96e-62 188 69 0 125 3 apaG Protein ApaG Shigella flexneri
Q0T8E5 4.96e-62 188 69 0 125 3 apaG Protein ApaG Shigella flexneri serotype 5b (strain 8401)
Q32K44 4.96e-62 188 69 0 125 3 apaG Protein ApaG Shigella dysenteriae serotype 1 (strain Sd197)
Q326I3 4.96e-62 188 69 0 125 3 apaG Protein ApaG Shigella boydii serotype 4 (strain Sb227)
B2U258 4.96e-62 188 69 0 125 3 apaG Protein ApaG Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LVU4 4.96e-62 188 69 0 125 3 apaG Protein ApaG Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1RGE7 4.96e-62 188 69 0 125 3 apaG Protein ApaG Escherichia coli (strain UTI89 / UPEC)
B1LFY6 4.96e-62 188 69 0 125 3 apaG Protein ApaG Escherichia coli (strain SMS-3-5 / SECEC)
B6HZ31 4.96e-62 188 69 0 125 3 apaG Protein ApaG Escherichia coli (strain SE11)
B7N7S5 4.96e-62 188 69 0 125 3 apaG Protein ApaG Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P62672 4.96e-62 188 69 0 125 3 apaG Protein ApaG Escherichia coli (strain K12)
B1IRC6 4.96e-62 188 69 0 125 3 apaG Protein ApaG Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P62673 4.96e-62 188 69 0 125 3 apaG Protein ApaG Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TLT7 4.96e-62 188 69 0 125 3 apaG Protein ApaG Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1A799 4.96e-62 188 69 0 125 3 apaG Protein ApaG Escherichia coli O1:K1 / APEC
A7ZW02 4.96e-62 188 69 0 125 3 apaG Protein ApaG Escherichia coli O9:H4 (strain HS)
B1XC51 4.96e-62 188 69 0 125 3 apaG Protein ApaG Escherichia coli (strain K12 / DH10B)
C4ZPX6 4.96e-62 188 69 0 125 3 apaG Protein ApaG Escherichia coli (strain K12 / MC4100 / BW2952)
B7M0E7 4.96e-62 188 69 0 125 3 apaG Protein ApaG Escherichia coli O8 (strain IAI1)
B7MNQ9 4.96e-62 188 69 0 125 3 apaG Protein ApaG Escherichia coli O81 (strain ED1a)
B7NHF6 4.96e-62 188 69 0 125 3 apaG Protein ApaG Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YZ88 4.96e-62 188 69 0 125 3 apaG Protein ApaG Escherichia coli O157:H7 (strain EC4115 / EHEC)
P62674 4.96e-62 188 69 0 125 3 apaG Protein ApaG Escherichia coli O157:H7
B7L4H3 4.96e-62 188 69 0 125 3 apaG Protein ApaG Escherichia coli (strain 55989 / EAEC)
B7MAH5 4.96e-62 188 69 0 125 3 apaG Protein ApaG Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UI98 4.96e-62 188 69 0 125 3 apaG Protein ApaG Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZHE3 4.96e-62 188 69 0 125 3 apaG Protein ApaG Escherichia coli O139:H28 (strain E24377A / ETEC)
Q8Z9J8 1.91e-61 187 68 0 125 3 apaG Protein ApaG Salmonella typhi
B1JKY4 2.13e-61 187 68 0 125 3 apaG Protein ApaG Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66EQ9 2.13e-61 187 68 0 125 3 apaG Protein ApaG Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K486 2.13e-61 187 68 0 125 3 apaG Protein ApaG Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A7FMC2 2.13e-61 187 68 0 125 3 apaG Protein ApaG Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A4TQD9 1.26e-60 184 67 0 125 3 apaG Protein ApaG Yersinia pestis (strain Pestoides F)
Q1CMT3 1.26e-60 184 67 0 125 3 apaG Protein ApaG Yersinia pestis bv. Antiqua (strain Nepal516)
A9QZZ1 1.26e-60 184 67 0 125 3 apaG Protein ApaG Yersinia pestis bv. Antiqua (strain Angola)
Q8ZIK6 1.26e-60 184 67 0 125 3 apaG Protein ApaG Yersinia pestis
Q1C0H6 1.26e-60 184 67 0 125 3 apaG Protein ApaG Yersinia pestis bv. Antiqua (strain Antiqua)
A4W6F6 2.3e-60 184 68 0 125 3 apaG Protein ApaG Enterobacter sp. (strain 638)
Q2NVX7 6.75e-60 183 65 0 125 3 apaG Protein ApaG Sodalis glossinidius (strain morsitans)
B5Y1Z5 1.59e-59 182 69 0 125 3 apaG Protein ApaG Klebsiella pneumoniae (strain 342)
A7MIB1 2.54e-58 179 64 0 125 3 apaG Protein ApaG Cronobacter sakazakii (strain ATCC BAA-894)
B4F2I3 3.68e-56 173 64 0 125 3 apaG Protein ApaG Proteus mirabilis (strain HI4320)
C5B7P0 2.65e-55 171 63 0 125 3 apaG Protein ApaG Edwardsiella ictaluri (strain 93-146)
B7VIE1 1.05e-48 154 58 0 121 3 apaG Protein ApaG Vibrio atlanticus (strain LGP32)
Q87ST7 5.7e-46 147 57 0 121 3 apaG Protein ApaG Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A7MWC5 1.24e-45 147 57 0 121 3 apaG Protein ApaG Vibrio campbellii (strain ATCC BAA-1116)
A8H0V1 6.41e-45 145 53 0 120 3 apaG Protein ApaG Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B0TV51 1.36e-44 144 55 0 117 3 apaG Protein ApaG Shewanella halifaxensis (strain HAW-EB4)
Q6LV42 1.59e-44 144 54 0 124 3 apaG Protein ApaG Photobacterium profundum (strain SS9)
C3LRH3 4.26e-44 143 56 0 116 3 apaG Protein ApaG Vibrio cholerae serotype O1 (strain M66-2)
Q9KUS3 4.26e-44 143 56 0 116 1 apaG Protein ApaG Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F8N1 4.26e-44 143 56 0 116 3 apaG Protein ApaG Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
A8FRV1 9.06e-44 142 56 0 119 3 apaG Protein ApaG Shewanella sediminis (strain HAW-EB3)
B8CSX6 4.48e-43 140 54 0 119 3 apaG Protein ApaG Shewanella piezotolerans (strain WP3 / JCM 13877)
Q7MP87 1.89e-41 136 49 0 121 3 apaG Protein ApaG Vibrio vulnificus (strain YJ016)
Q8DED1 1.89e-41 136 49 0 121 3 apaG Protein ApaG Vibrio vulnificus (strain CMCP6)
B1KGH8 4.68e-41 135 56 0 119 3 apaG Protein ApaG Shewanella woodyi (strain ATCC 51908 / MS32)
B5ENR7 6.37e-40 132 50 0 120 3 apaG Protein ApaG Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J8G8 6.37e-40 132 50 0 120 3 apaG Protein ApaG Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
Q3SGR3 6.81e-40 132 50 1 127 3 apaG Protein ApaG Thiobacillus denitrificans (strain ATCC 25259)
A3QBA2 6.08e-39 130 52 0 119 3 apaG Protein ApaG Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q07YJ7 7.99e-39 129 52 0 114 3 apaG Protein ApaG Shewanella frigidimarina (strain NCIMB 400)
Q0HS05 1.4e-38 129 51 0 119 3 apaG Protein ApaG Shewanella sp. (strain MR-7)
A6WK58 3.07e-38 128 50 0 120 3 apaG Protein ApaG Shewanella baltica (strain OS185)
A3D187 3.07e-38 128 50 0 120 3 apaG Protein ApaG Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8EB36 3.07e-38 128 50 0 120 3 apaG Protein ApaG Shewanella baltica (strain OS223)
A0L065 3.27e-38 128 50 0 119 3 apaG Protein ApaG Shewanella sp. (strain ANA-3)
Q0HLT3 4.35e-38 127 50 0 119 3 apaG Protein ApaG Shewanella sp. (strain MR-4)
Q5P714 6.02e-38 127 46 1 127 3 apaG Protein ApaG Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
A6UZ95 1.08e-37 127 49 0 120 3 apaG Protein ApaG Pseudomonas aeruginosa (strain PA7)
A9L437 1.63e-37 126 50 0 120 3 apaG Protein ApaG Shewanella baltica (strain OS195)
Q8EB92 1.9e-37 126 50 0 120 1 apaG Protein ApaG Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A1RMU9 2.27e-37 126 50 0 120 3 apaG Protein ApaG Shewanella sp. (strain W3-18-1)
A4Y434 2.27e-37 126 50 0 120 3 apaG Protein ApaG Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A1K3W2 3.24e-37 125 48 0 120 3 apaG Protein ApaG Azoarcus sp. (strain BH72)
Q9I5U6 4.27e-37 125 49 0 120 3 apaG Protein ApaG Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02TH2 4.27e-37 125 49 0 120 3 apaG Protein ApaG Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V4H7 4.27e-37 125 49 0 120 3 apaG Protein ApaG Pseudomonas aeruginosa (strain LESB58)
B0UC46 1.3e-36 124 53 0 114 3 apaG Protein ApaG Methylobacterium sp. (strain 4-46)
Q82UC1 1.9e-36 124 48 0 120 3 apaG Protein ApaG Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q0AHS7 2.79e-36 123 47 1 127 3 apaG Protein ApaG Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
B8IN72 1.28e-35 122 53 0 114 3 apaG Protein ApaG Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
Q2Y6G0 3.97e-35 120 46 1 127 3 apaG Protein ApaG Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
B2FPG4 4.14e-35 120 45 0 119 3 apaG Protein ApaG Stenotrophomonas maltophilia (strain K279a)
Q47AB8 5.94e-35 120 46 1 127 3 apaG Protein ApaG Dechloromonas aromatica (strain RCB)
B1LXV0 6.08e-35 120 54 0 112 3 apaG Protein ApaG Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
B8ELJ0 7.9e-35 119 52 0 113 3 apaG Protein ApaG Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
B1JE08 8.93e-35 119 43 0 120 3 apaG Protein ApaG Pseudomonas putida (strain W619)
Q88QT7 1.94e-34 118 44 0 120 3 apaG Protein ApaG Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5VXJ4 1.94e-34 118 44 0 120 3 apaG Protein ApaG Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q5GWB8 2.51e-34 118 44 1 127 3 apaG Protein ApaG Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SPT2 2.51e-34 118 44 1 127 3 apaG Protein ApaG Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2NZI3 2.51e-34 118 44 1 127 3 apaG Protein ApaG Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q1GXY8 3.45e-34 118 44 0 119 3 apaG Protein ApaG Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q1IG21 3.73e-34 118 43 0 120 3 apaG Protein ApaG Pseudomonas entomophila (strain L48)
B0KJ92 4.03e-34 117 44 0 120 3 apaG Protein ApaG Pseudomonas putida (strain GB-1)
Q98BB4 4.29e-34 118 48 0 115 3 apaG Protein ApaG Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q3BX83 4.68e-34 117 44 1 127 3 apaG Protein ApaG Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
A7HQ48 5.05e-34 117 52 0 112 3 apaG Protein ApaG Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
Q0ASF3 6.09e-34 117 51 0 112 3 apaG Protein ApaG Maricaulis maris (strain MCS10)
Q8PP26 8.08e-34 117 43 1 127 1 apaG Protein ApaG Xanthomonas axonopodis pv. citri (strain 306)
Q8PCE4 1.02e-33 117 43 1 127 3 apaG Protein ApaG Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RUI4 1.02e-33 117 43 1 127 3 apaG Protein ApaG Xanthomonas campestris pv. campestris (strain B100)
Q4UR38 1.02e-33 117 43 1 127 3 apaG Protein ApaG Xanthomonas campestris pv. campestris (strain 8004)
Q8XVF3 1.03e-33 117 45 0 120 3 apaG Protein ApaG Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
C1DIX0 1.15e-33 116 45 0 120 3 apaG Protein ApaG Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
A4XZJ5 2.39e-33 115 45 0 120 3 apaG Protein ApaG Pseudomonas mendocina (strain ymp)
B1ZJ42 3.06e-33 115 52 0 112 3 apaG Protein ApaG Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
A9VZN6 3.49e-33 115 52 0 112 3 apaG Protein ApaG Methylorubrum extorquens (strain PA1)
B7L060 3.49e-33 115 52 0 112 3 apaG Protein ApaG Methylorubrum extorquens (strain CM4 / NCIMB 13688)
B6IPQ9 8.63e-33 114 51 0 113 3 apaG Protein ApaG Rhodospirillum centenum (strain ATCC 51521 / SW)
Q3K5T1 1.03e-32 114 43 0 120 3 apaG Protein ApaG Pseudomonas fluorescens (strain Pf0-1)
A8ILE7 1.09e-32 114 46 0 115 3 apaG Protein ApaG Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
B2III9 1.25e-32 114 49 0 113 3 apaG Protein ApaG Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
Q87C84 1.25e-32 114 45 1 127 3 apaG Protein ApaG Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B0U354 1.25e-32 114 45 1 127 3 apaG Protein ApaG Xylella fastidiosa (strain M12)
B2I5R5 1.25e-32 114 45 1 127 3 apaG Protein ApaG Xylella fastidiosa (strain M23)
Q1QZ30 1.29e-32 114 45 2 121 3 apaG Protein ApaG Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q12K58 1.39e-32 114 50 0 115 3 apaG Protein ApaG Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q9PBJ5 2.07e-32 113 44 1 127 3 apaG Protein ApaG Xylella fastidiosa (strain 9a5c)
Q2VZE7 7.01e-32 112 50 0 113 3 apaG Protein ApaG Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
B0CJT2 7.82e-32 112 50 0 114 3 apaG Protein ApaG Brucella suis (strain ATCC 23445 / NCTC 10510)
A9M7Z1 7.82e-32 112 50 0 114 3 apaG Protein ApaG Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q7VU61 9.38e-32 112 47 0 120 1 apaG Protein ApaG Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W393 9.38e-32 112 47 0 120 3 apaG Protein ApaG Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WEL1 9.38e-32 112 47 0 120 3 apaG Protein ApaG Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q89VE6 1.24e-31 111 48 0 113 3 apaG Protein ApaG Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q8G2L5 2.23e-31 111 50 0 114 3 apaG Protein ApaG Brucella suis biovar 1 (strain 1330)
Q8YFA4 2.43e-31 110 49 0 114 3 apaG Protein ApaG Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RH21 2.43e-31 110 49 0 114 3 apaG Protein ApaG Brucella melitensis biotype 2 (strain ATCC 23457)
Q57F54 2.43e-31 110 49 0 114 3 apaG Protein ApaG Brucella abortus biovar 1 (strain 9-941)
Q2YPH0 2.43e-31 110 49 0 114 3 apaG Protein ApaG Brucella abortus (strain 2308)
B2S946 2.43e-31 110 49 0 114 3 apaG Protein ApaG Brucella abortus (strain S19)
C3MFB9 3.49e-31 110 46 0 113 3 apaG Protein ApaG Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q88A47 4.08e-31 110 41 0 120 3 apaG Protein ApaG Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
A6U5R0 7.48e-31 109 46 0 113 3 apaG Protein ApaG Sinorhizobium medicae (strain WSM419)
Q92S97 8.07e-31 109 46 0 113 3 apaG Protein ApaG Rhizobium meliloti (strain 1021)
A7ICI5 9.93e-31 109 48 1 114 3 apaG Protein ApaG Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
Q4K4X4 1.49e-30 108 40 0 120 3 apaG Protein ApaG Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q8UI68 1.91e-30 108 47 0 113 3 apaG Protein ApaG Agrobacterium fabrum (strain C58 / ATCC 33970)
A6WVX4 5.21e-30 107 48 0 114 3 apaG Protein ApaG Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
B5ZNW9 5.26e-30 107 46 0 113 3 apaG Protein ApaG Rhizobium leguminosarum bv. trifolii (strain WSM2304)
C3K328 5.41e-30 107 40 0 120 3 apaG Protein ApaG Pseudomonas fluorescens (strain SBW25)
Q2KCU6 1.47e-29 106 46 0 113 3 apaG Protein ApaG Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
B6JD70 2.39e-29 105 47 0 113 3 apaG Protein ApaG Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
B3PNM4 5.36e-29 105 46 0 113 3 apaG Protein ApaG Rhizobium etli (strain CIAT 652)
A1W2Y8 3.53e-28 103 48 0 104 3 apaG Protein ApaG Acidovorax sp. (strain JS42)
Q9RXS8 5e-28 102 42 1 121 3 apaG Protein ApaG Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
A4Z2J6 5.7e-28 102 48 0 112 3 apaG Protein ApaG Bradyrhizobium sp. (strain ORS 278)
B9JQX3 1.12e-27 101 45 0 113 3 apaG Protein ApaG Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
Q6MK56 1.14e-27 101 42 0 121 3 apaG Protein ApaG Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
B3QCE1 1.24e-27 101 46 0 113 3 apaG Protein ApaG Rhodopseudomonas palustris (strain TIE-1)
Q6N0J2 1.24e-27 101 46 0 113 3 apaG Protein ApaG Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
A5EA34 1.58e-27 101 46 0 113 3 apaG Protein ApaG Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
B8JAJ1 1.99e-26 98 45 1 114 3 apaG Protein ApaG Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
Q2IGT4 2.06e-26 98 43 1 114 3 apaG Protein ApaG Anaeromyxobacter dehalogenans (strain 2CP-C)
B4UHA8 3.82e-26 97 45 1 114 3 apaG Protein ApaG Anaeromyxobacter sp. (strain K)
Q9A655 8.72e-26 97 44 0 115 3 apaG Protein ApaG Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
C0R462 9.46e-26 97 42 1 115 3 apaG Protein ApaG Wolbachia sp. subsp. Drosophila simulans (strain wRi)
Q73G26 9.46e-26 97 42 1 115 3 apaG Protein ApaG Wolbachia pipientis wMel
Q7NW07 2.12e-25 95 40 0 120 3 apaG Protein ApaG Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q60C69 4.27e-24 92 42 0 120 3 apaG Protein ApaG Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
A6H7H7 1.7e-18 83 43 2 123 2 FBXO3 F-box only protein 3 Bos taurus
Q9UK99 1.95e-18 82 43 2 123 1 FBXO3 F-box only protein 3 Homo sapiens
D4ABP9 2.04e-18 82 43 2 123 3 Fbxo3 F-box only protein 3 Rattus norvegicus
Q9DC63 2.99e-18 82 43 2 123 1 Fbxo3 F-box only protein 3 Mus musculus
Q91VA6 1.29e-09 57 30 1 113 1 Poldip2 Polymerase delta-interacting protein 2 Mus musculus
Q9Y2S7 1.3e-09 57 30 1 113 1 POLDIP2 Polymerase delta-interacting protein 2 Homo sapiens
Q9LND7 4.17e-06 47 27 4 133 1 SKIP16 F-box protein SKIP16 Arabidopsis thaliana

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS15650
Feature type CDS
Gene apaG
Product Co2+/Mg2+ efflux protein ApaG
Location 126386 - 126763 (strand: -1)
Length 378 (nucleotides) / 125 (amino acids)

Contig

Accession term accessions NZ_VXKB01000005 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 213534 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1102
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04379 ApaG domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2967 Inorganic ion transport and metabolism (P) P Uncharacterized conserved protein ApaG affecting Mg2+/Co2+ transport

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K06195 ApaG protein - -

Protein Sequence

MNNGPKICIQVQSVYIESQSEPDAERYVFAYTVSIRNLGRHTVQLISRYWRITNSEGRQTEVQGEGVVGEQPVIEPGEEYRYTSGTVLETPLGTMEGYYTMVDHKGENFISEIPVFRLAIATFVH

Flanking regions ( +/- flanking 50bp)

CTGATGGCTAATTACCTGGCGGATAATCCCGCCTCATAGGGAGTTCCATAATGAATAACGGCCCGAAAATTTGTATTCAGGTTCAGAGTGTTTATATCGAAAGCCAGTCTGAGCCGGATGCTGAGCGCTATGTTTTCGCATATACCGTTTCTATCCGGAATCTGGGTCGTCATACCGTTCAGCTAATCAGCCGCTACTGGCGTATCACCAACAGCGAAGGCCGCCAGACTGAAGTTCAGGGGGAAGGCGTTGTTGGTGAACAACCGGTCATTGAGCCGGGTGAAGAGTATCGTTACACCAGCGGAACCGTTCTGGAAACACCGCTGGGCACCATGGAAGGTTATTACACTATGGTGGATCACAAAGGTGAGAATTTCATCAGTGAAATTCCTGTTTTCCGGCTCGCAATTGCAACTTTTGTTCATTAATCCGTTATGGCAACCTACCTTATCGGCGATATTCACGGCTGTTACCGTGA