Homologs in group_2287

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_17565 FBDBKF_17565 96.4 Morganella morganii S1 rplJ 50S ribosomal protein L10
EHELCC_18050 EHELCC_18050 96.4 Morganella morganii S2 rplJ 50S ribosomal protein L10
NLDBIP_18100 NLDBIP_18100 96.4 Morganella morganii S4 rplJ 50S ribosomal protein L10
LHKJJB_18295 LHKJJB_18295 96.4 Morganella morganii S3 rplJ 50S ribosomal protein L10
HKOGLL_17905 HKOGLL_17905 96.4 Morganella morganii S5 rplJ 50S ribosomal protein L10
PMI_RS13765 PMI_RS13765 92.1 Proteus mirabilis HI4320 rplJ 50S ribosomal protein L10

Distribution of the homologs in the orthogroup group_2287

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2287

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4EYV1 6.14e-105 300 92 0 165 3 rplJ Large ribosomal subunit protein uL10 Proteus mirabilis (strain HI4320)
A8G8E5 9.9e-100 286 89 0 165 3 rplJ Large ribosomal subunit protein uL10 Serratia proteamaculans (strain 568)
Q7N9A6 7.01e-98 282 86 0 163 3 rplJ Large ribosomal subunit protein uL10 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A7MQP7 2.11e-96 278 86 0 165 3 rplJ Large ribosomal subunit protein uL10 Cronobacter sakazakii (strain ATCC BAA-894)
A4W5A5 2.6e-96 278 86 0 165 3 rplJ Large ribosomal subunit protein uL10 Enterobacter sp. (strain 638)
B2VG94 2.91e-96 278 85 0 164 3 rplJ Large ribosomal subunit protein uL10 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q3YUZ9 5.37e-96 277 86 0 165 3 rplJ Large ribosomal subunit protein uL10 Shigella sonnei (strain Ss046)
P0A7J6 5.37e-96 277 86 0 165 3 rplJ Large ribosomal subunit protein uL10 Shigella flexneri
Q0SY15 5.37e-96 277 86 0 165 3 rplJ Large ribosomal subunit protein uL10 Shigella flexneri serotype 5b (strain 8401)
Q32AF7 5.37e-96 277 86 0 165 3 rplJ Large ribosomal subunit protein uL10 Shigella dysenteriae serotype 1 (strain Sd197)
Q31U12 5.37e-96 277 86 0 165 3 rplJ Large ribosomal subunit protein uL10 Shigella boydii serotype 4 (strain Sb227)
B2TWH1 5.37e-96 277 86 0 165 3 rplJ Large ribosomal subunit protein uL10 Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LUL7 5.37e-96 277 86 0 165 3 rplJ Large ribosomal subunit protein uL10 Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1R5V0 5.37e-96 277 86 0 165 3 rplJ Large ribosomal subunit protein uL10 Escherichia coli (strain UTI89 / UPEC)
B1LNT7 5.37e-96 277 86 0 165 3 rplJ Large ribosomal subunit protein uL10 Escherichia coli (strain SMS-3-5 / SECEC)
B6I5J5 5.37e-96 277 86 0 165 3 rplJ Large ribosomal subunit protein uL10 Escherichia coli (strain SE11)
B7NFS5 5.37e-96 277 86 0 165 3 rplJ Large ribosomal subunit protein uL10 Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A7J3 5.37e-96 277 86 0 165 1 rplJ Large ribosomal subunit protein uL10 Escherichia coli (strain K12)
B1IUR2 5.37e-96 277 86 0 165 3 rplJ Large ribosomal subunit protein uL10 Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A7J4 5.37e-96 277 86 0 165 3 rplJ Large ribosomal subunit protein uL10 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TA80 5.37e-96 277 86 0 165 3 rplJ Large ribosomal subunit protein uL10 Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AIF7 5.37e-96 277 86 0 165 3 rplJ Large ribosomal subunit protein uL10 Escherichia coli O1:K1 / APEC
A8A784 5.37e-96 277 86 0 165 3 rplJ Large ribosomal subunit protein uL10 Escherichia coli O9:H4 (strain HS)
B1XBY7 5.37e-96 277 86 0 165 3 rplJ Large ribosomal subunit protein uL10 Escherichia coli (strain K12 / DH10B)
C5A0S5 5.37e-96 277 86 0 165 3 rplJ Large ribosomal subunit protein uL10 Escherichia coli (strain K12 / MC4100 / BW2952)
B7M732 5.37e-96 277 86 0 165 3 rplJ Large ribosomal subunit protein uL10 Escherichia coli O8 (strain IAI1)
B7MR71 5.37e-96 277 86 0 165 3 rplJ Large ribosomal subunit protein uL10 Escherichia coli O81 (strain ED1a)
B7NRR3 5.37e-96 277 86 0 165 3 rplJ Large ribosomal subunit protein uL10 Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5Z081 5.37e-96 277 86 0 165 3 rplJ Large ribosomal subunit protein uL10 Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A7J5 5.37e-96 277 86 0 165 3 rplJ Large ribosomal subunit protein uL10 Escherichia coli O157:H7
B7LA78 5.37e-96 277 86 0 165 3 rplJ Large ribosomal subunit protein uL10 Escherichia coli (strain 55989 / EAEC)
B7MIX1 5.37e-96 277 86 0 165 3 rplJ Large ribosomal subunit protein uL10 Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UPE0 5.37e-96 277 86 0 165 3 rplJ Large ribosomal subunit protein uL10 Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZUJ8 5.37e-96 277 86 0 165 3 rplJ Large ribosomal subunit protein uL10 Escherichia coli O139:H28 (strain E24377A / ETEC)
P0A297 1e-95 276 85 0 165 3 rplJ Large ribosomal subunit protein uL10 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A298 1e-95 276 85 0 165 3 rplJ Large ribosomal subunit protein uL10 Salmonella typhi
B4TQJ3 1e-95 276 85 0 165 3 rplJ Large ribosomal subunit protein uL10 Salmonella schwarzengrund (strain CVM19633)
B5BJQ1 1e-95 276 85 0 165 3 rplJ Large ribosomal subunit protein uL10 Salmonella paratyphi A (strain AKU_12601)
C0Q2R5 1e-95 276 85 0 165 3 rplJ Large ribosomal subunit protein uL10 Salmonella paratyphi C (strain RKS4594)
A9N0J1 1e-95 276 85 0 165 3 rplJ Large ribosomal subunit protein uL10 Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PK95 1e-95 276 85 0 165 3 rplJ Large ribosomal subunit protein uL10 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T0Y7 1e-95 276 85 0 165 3 rplJ Large ribosomal subunit protein uL10 Salmonella newport (strain SL254)
B4TCS2 1e-95 276 85 0 165 3 rplJ Large ribosomal subunit protein uL10 Salmonella heidelberg (strain SL476)
B5RFK3 1e-95 276 85 0 165 3 rplJ Large ribosomal subunit protein uL10 Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QYD6 1e-95 276 85 0 165 3 rplJ Large ribosomal subunit protein uL10 Salmonella enteritidis PT4 (strain P125109)
B5FQJ7 1e-95 276 85 0 165 3 rplJ Large ribosomal subunit protein uL10 Salmonella dublin (strain CT_02021853)
Q57H71 1e-95 276 85 0 165 3 rplJ Large ribosomal subunit protein uL10 Salmonella choleraesuis (strain SC-B67)
A9MHF4 1e-95 276 85 0 165 3 rplJ Large ribosomal subunit protein uL10 Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5F0W5 1e-95 276 85 0 165 3 rplJ Large ribosomal subunit protein uL10 Salmonella agona (strain SL483)
A6TGN8 1e-95 276 85 0 165 3 rplJ Large ribosomal subunit protein uL10 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XYF7 1e-95 276 85 0 165 3 rplJ Large ribosomal subunit protein uL10 Klebsiella pneumoniae (strain 342)
Q6DAN2 1.2e-95 276 85 0 165 3 rplJ Large ribosomal subunit protein uL10 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A8AKU1 1.87e-95 276 85 0 165 3 rplJ Large ribosomal subunit protein uL10 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
C5BHE2 5.37e-95 275 85 0 165 3 rplJ Large ribosomal subunit protein uL10 Edwardsiella ictaluri (strain 93-146)
C6DHR3 5.74e-95 275 84 0 165 3 rplJ Large ribosomal subunit protein uL10 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q2NWR8 7.8e-95 274 84 0 165 3 rplJ Large ribosomal subunit protein uL10 Sodalis glossinidius (strain morsitans)
A1JIH8 3.51e-92 268 84 0 164 3 rplJ Large ribosomal subunit protein uL10 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B1JJJ6 6.2e-92 267 84 0 165 3 rplJ Large ribosomal subunit protein uL10 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66FQ4 6.2e-92 267 84 0 165 3 rplJ Large ribosomal subunit protein uL10 Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TS31 6.2e-92 267 84 0 165 3 rplJ Large ribosomal subunit protein uL10 Yersinia pestis (strain Pestoides F)
Q1CN80 6.2e-92 267 84 0 165 3 rplJ Large ribosomal subunit protein uL10 Yersinia pestis bv. Antiqua (strain Nepal516)
A9R0H6 6.2e-92 267 84 0 165 3 rplJ Large ribosomal subunit protein uL10 Yersinia pestis bv. Antiqua (strain Angola)
Q8ZAP3 6.2e-92 267 84 0 165 3 rplJ Large ribosomal subunit protein uL10 Yersinia pestis
B2K110 6.2e-92 267 84 0 165 3 rplJ Large ribosomal subunit protein uL10 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C1T9 6.2e-92 267 84 0 165 3 rplJ Large ribosomal subunit protein uL10 Yersinia pestis bv. Antiqua (strain Antiqua)
A7FNI5 6.2e-92 267 84 0 165 3 rplJ Large ribosomal subunit protein uL10 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A0KQA7 5.09e-91 265 80 0 165 3 rplJ Large ribosomal subunit protein uL10 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A4SHU7 6.14e-91 265 81 0 165 3 rplJ Large ribosomal subunit protein uL10 Aeromonas salmonicida (strain A449)
A6VKC7 1.19e-88 259 81 2 166 3 rplJ Large ribosomal subunit protein uL10 Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
B8F6N1 1.38e-88 258 80 2 166 3 rplJ Large ribosomal subunit protein uL10 Glaesserella parasuis serovar 5 (strain SH0165)
Q9CK89 1.5e-88 258 81 2 166 3 rplJ Large ribosomal subunit protein uL10 Pasteurella multocida (strain Pm70)
C4LBV4 3.08e-88 258 78 0 164 3 rplJ Large ribosomal subunit protein uL10 Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
A5UHD1 4.7e-88 257 80 2 166 3 rplJ Large ribosomal subunit protein uL10 Haemophilus influenzae (strain PittGG)
A5UE96 1.71e-87 256 79 2 166 3 rplJ Large ribosomal subunit protein uL10 Haemophilus influenzae (strain PittEE)
B3GYU6 2.81e-87 255 79 2 166 3 rplJ Large ribosomal subunit protein uL10 Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N318 2.81e-87 255 79 2 166 3 rplJ Large ribosomal subunit protein uL10 Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q65W44 4.85e-87 254 79 2 166 3 rplJ Large ribosomal subunit protein uL10 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q0I0V0 5.24e-87 254 79 2 166 3 rplJ Large ribosomal subunit protein uL10 Histophilus somni (strain 129Pt)
A8G1F7 8.7e-87 254 78 0 165 3 rplJ Large ribosomal subunit protein uL10 Shewanella sediminis (strain HAW-EB3)
B0UUZ6 8.77e-87 254 79 2 166 3 rplJ Large ribosomal subunit protein uL10 Histophilus somni (strain 2336)
Q4QMS7 8.87e-87 254 78 2 166 3 rplJ Large ribosomal subunit protein uL10 Haemophilus influenzae (strain 86-028NP)
P44350 1.26e-86 253 78 2 166 1 rplJ Large ribosomal subunit protein uL10 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A8GYW7 1e-85 251 76 0 165 3 rplJ Large ribosomal subunit protein uL10 Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
A3Q973 1.06e-85 251 76 0 165 3 rplJ Large ribosomal subunit protein uL10 Shewanella loihica (strain ATCC BAA-1088 / PV-4)
B0TM21 1.96e-85 251 76 0 165 3 rplJ Large ribosomal subunit protein uL10 Shewanella halifaxensis (strain HAW-EB4)
C4K4F3 5.98e-85 249 76 0 164 3 rplJ Large ribosomal subunit protein uL10 Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
B8CNC3 6.82e-85 249 76 0 165 3 rplJ Large ribosomal subunit protein uL10 Shewanella piezotolerans (strain WP3 / JCM 13877)
B1KMZ2 1.11e-84 249 76 0 165 3 rplJ Large ribosomal subunit protein uL10 Shewanella woodyi (strain ATCC 51908 / MS32)
Q7VKL4 1.77e-84 248 77 2 166 3 rplJ Large ribosomal subunit protein uL10 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q089R3 2.13e-84 248 76 0 165 3 rplJ Large ribosomal subunit protein uL10 Shewanella frigidimarina (strain NCIMB 400)
C3LR58 6.51e-84 246 78 1 165 3 rplJ Large ribosomal subunit protein uL10 Vibrio cholerae serotype O1 (strain M66-2)
Q9KV32 6.51e-84 246 78 1 165 3 rplJ Large ribosomal subunit protein uL10 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F3P3 6.51e-84 246 78 1 165 3 rplJ Large ribosomal subunit protein uL10 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q0I0B4 8.97e-84 246 75 0 165 3 rplJ Large ribosomal subunit protein uL10 Shewanella sp. (strain MR-7)
Q0HNU6 8.97e-84 246 75 0 165 3 rplJ Large ribosomal subunit protein uL10 Shewanella sp. (strain MR-4)
A0KRL5 8.97e-84 246 75 0 165 3 rplJ Large ribosomal subunit protein uL10 Shewanella sp. (strain ANA-3)
Q8EK76 8.97e-84 246 75 0 165 3 rplJ Large ribosomal subunit protein uL10 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
B6ENR5 2.48e-83 245 76 1 165 3 rplJ Large ribosomal subunit protein uL10 Aliivibrio salmonicida (strain LFI1238)
Q12SW8 9.16e-83 244 75 0 165 3 rplJ Large ribosomal subunit protein uL10 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q7MGR6 1.69e-82 243 76 1 165 3 rplJ Large ribosomal subunit protein uL10 Vibrio vulnificus (strain YJ016)
Q8DD22 1.69e-82 243 76 1 165 3 rplJ Large ribosomal subunit protein uL10 Vibrio vulnificus (strain CMCP6)
A1REA5 1.75e-82 243 75 0 165 3 rplJ Large ribosomal subunit protein uL10 Shewanella sp. (strain W3-18-1)
A4YBZ2 1.75e-82 243 75 0 165 3 rplJ Large ribosomal subunit protein uL10 Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A9KW93 1.75e-82 243 75 0 165 3 rplJ Large ribosomal subunit protein uL10 Shewanella baltica (strain OS195)
A6WHR9 1.75e-82 243 75 0 165 3 rplJ Large ribosomal subunit protein uL10 Shewanella baltica (strain OS185)
B8EBL4 1.75e-82 243 75 0 165 3 rplJ Large ribosomal subunit protein uL10 Shewanella baltica (strain OS223)
A1S209 1.83e-82 243 75 0 165 3 rplJ Large ribosomal subunit protein uL10 Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q87KQ2 1.21e-81 241 76 1 165 3 rplJ Large ribosomal subunit protein uL10 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A1T067 2.8e-81 240 74 0 163 3 rplJ Large ribosomal subunit protein uL10 Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q6LLW0 1.06e-80 238 75 1 165 3 rplJ Large ribosomal subunit protein uL10 Photobacterium profundum (strain SS9)
B5FC90 2.61e-80 238 75 1 165 3 rplJ Large ribosomal subunit protein uL10 Aliivibrio fischeri (strain MJ11)
A6W3A1 1.29e-78 233 74 1 163 3 rplJ Large ribosomal subunit protein uL10 Marinomonas sp. (strain MWYL1)
Q1R0I4 5.62e-78 232 71 0 163 3 rplJ Large ribosomal subunit protein uL10 Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q3K5X9 8.04e-77 229 71 1 165 3 rplJ Large ribosomal subunit protein uL10 Pseudomonas fluorescens (strain Pf0-1)
Q4K524 9.17e-77 229 70 1 165 3 rplJ Large ribosomal subunit protein uL10 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q9HWC7 1.39e-76 228 69 1 165 1 rplJ Large ribosomal subunit protein uL10 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02T89 1.39e-76 228 69 1 165 3 rplJ Large ribosomal subunit protein uL10 Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V635 1.39e-76 228 69 1 165 3 rplJ Large ribosomal subunit protein uL10 Pseudomonas aeruginosa (strain LESB58)
A6UZH9 1.39e-76 228 69 1 165 3 rplJ Large ribosomal subunit protein uL10 Pseudomonas aeruginosa (strain PA7)
B1JDX3 2.2e-76 228 72 1 165 3 rplJ Large ribosomal subunit protein uL10 Pseudomonas putida (strain W619)
C1DKK3 1.36e-75 226 70 1 165 3 rplJ Large ribosomal subunit protein uL10 Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q88QP3 1.47e-75 226 72 1 164 3 rplJ Large ribosomal subunit protein uL10 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KK58 1.47e-75 226 72 1 164 3 rplJ Large ribosomal subunit protein uL10 Pseudomonas putida (strain GB-1)
Q1IFX5 2.43e-75 225 72 1 165 3 rplJ Large ribosomal subunit protein uL10 Pseudomonas entomophila (strain L48)
A4XZ99 8e-75 224 69 1 165 3 rplJ Large ribosomal subunit protein uL10 Pseudomonas mendocina (strain ymp)
Q47UV7 9.72e-74 221 68 1 163 3 rplJ Large ribosomal subunit protein uL10 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
C3K2Y5 1.1e-73 221 69 1 165 3 rplJ Large ribosomal subunit protein uL10 Pseudomonas fluorescens (strain SBW25)
Q889Y0 3.21e-73 220 69 1 165 3 rplJ Large ribosomal subunit protein uL10 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
A4VHM1 5.03e-73 219 68 1 165 3 rplJ Large ribosomal subunit protein uL10 Stutzerimonas stutzeri (strain A1501)
Q4ZMN5 1.06e-72 218 69 1 165 3 rplJ Large ribosomal subunit protein uL10 Pseudomonas syringae pv. syringae (strain B728a)
Q48D27 1.06e-72 218 69 1 165 3 rplJ Large ribosomal subunit protein uL10 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q3ILQ2 3.05e-71 214 67 1 163 3 rplJ Large ribosomal subunit protein uL10 Pseudoalteromonas translucida (strain TAC 125)
Q1LSX9 6.08e-68 206 63 0 162 3 rplJ Large ribosomal subunit protein uL10 Baumannia cicadellinicola subsp. Homalodisca coagulata
Q2S903 2.4e-59 185 57 2 176 3 rplJ Large ribosomal subunit protein uL10 Hahella chejuensis (strain KCTC 2396)
Q0VSM4 1.12e-55 176 55 1 175 3 rplJ Large ribosomal subunit protein uL10 Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q21M95 2.96e-54 172 54 2 176 3 rplJ Large ribosomal subunit protein uL10 Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
C5BQ37 9.93e-54 171 52 2 176 3 rplJ Large ribosomal subunit protein uL10 Teredinibacter turnerae (strain ATCC 39867 / T7901)
B8D6V2 2.42e-52 167 47 0 165 3 rplJ Large ribosomal subunit protein uL10 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57148 2.42e-52 167 47 0 165 3 rplJ Large ribosomal subunit protein uL10 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D8J8 2.42e-52 167 47 0 165 3 rplJ Large ribosomal subunit protein uL10 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
A1TYI8 5.11e-52 166 53 2 176 3 rplJ Large ribosomal subunit protein uL10 Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
A1WVD1 4.35e-51 164 50 1 175 3 rplJ Large ribosomal subunit protein uL10 Halorhodospira halophila (strain DSM 244 / SL1)
Q89B18 1.48e-50 162 44 1 168 3 rplJ Large ribosomal subunit protein uL10 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q31IZ1 3.08e-48 156 50 1 164 3 rplJ Large ribosomal subunit protein uL10 Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q0BKC2 4.97e-48 156 50 1 161 3 rplJ Large ribosomal subunit protein uL10 Francisella tularensis subsp. holarctica (strain OSU18)
Q2A1M5 4.97e-48 156 50 1 161 3 rplJ Large ribosomal subunit protein uL10 Francisella tularensis subsp. holarctica (strain LVS)
A7NEC2 4.97e-48 156 50 1 161 3 rplJ Large ribosomal subunit protein uL10 Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
A4IW97 6.68e-48 155 50 1 161 3 rplJ Large ribosomal subunit protein uL10 Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NID4 6.68e-48 155 50 1 161 3 rplJ Large ribosomal subunit protein uL10 Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
A0Q869 6.68e-48 155 50 1 161 3 rplJ Large ribosomal subunit protein uL10 Francisella tularensis subsp. novicida (strain U112)
Q14JT7 6.68e-48 155 50 1 161 3 rplJ Large ribosomal subunit protein uL10 Francisella tularensis subsp. tularensis (strain FSC 198)
A5IHS3 1.5e-47 155 50 1 172 3 rplJ Large ribosomal subunit protein uL10 Legionella pneumophila (strain Corby)
Q8D235 1.65e-47 154 41 0 160 3 rplJ Large ribosomal subunit protein uL10 Wigglesworthia glossinidia brevipalpis
B0TX08 1.76e-47 155 50 1 161 3 rplJ Large ribosomal subunit protein uL10 Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
B2SFD4 1.92e-47 154 50 1 161 3 rplJ Large ribosomal subunit protein uL10 Francisella tularensis subsp. mediasiatica (strain FSC147)
Q8KA68 2.56e-47 154 46 0 165 3 rplJ Large ribosomal subunit protein uL10 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q5WZM1 3.31e-47 154 50 1 172 3 rplJ Large ribosomal subunit protein uL10 Legionella pneumophila (strain Lens)
Q5ZYQ2 3.31e-47 154 50 1 172 3 rplJ Large ribosomal subunit protein uL10 Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q5X868 3.31e-47 154 50 1 172 3 rplJ Large ribosomal subunit protein uL10 Legionella pneumophila (strain Paris)
Q0ABI4 1.05e-45 150 46 1 175 3 rplJ Large ribosomal subunit protein uL10 Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
A5WH37 1.16e-45 150 50 1 175 3 rplJ Large ribosomal subunit protein uL10 Psychrobacter sp. (strain PRwf-1)
B8GV67 2.96e-45 149 50 1 175 3 rplJ Large ribosomal subunit protein uL10 Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q492B7 3.02e-45 149 43 0 163 3 rplJ Large ribosomal subunit protein uL10 Blochmanniella pennsylvanica (strain BPEN)
B0VDG4 1.18e-44 147 46 2 166 3 rplJ Large ribosomal subunit protein uL10 Acinetobacter baumannii (strain AYE)
A3M1G1 1.18e-44 147 46 2 166 3 rplJ Large ribosomal subunit protein uL10 Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0VLZ8 1.18e-44 147 46 2 166 3 rplJ Large ribosomal subunit protein uL10 Acinetobacter baumannii (strain SDF)
B2I1Y9 1.18e-44 147 46 2 166 3 rplJ Large ribosomal subunit protein uL10 Acinetobacter baumannii (strain ACICU)
B7I358 1.18e-44 147 46 2 166 3 rplJ Large ribosomal subunit protein uL10 Acinetobacter baumannii (strain AB0057)
B7H1K0 1.18e-44 147 46 2 166 3 rplJ Large ribosomal subunit protein uL10 Acinetobacter baumannii (strain AB307-0294)
Q83ET2 1.46e-44 147 46 2 175 3 rplJ Large ribosomal subunit protein uL10 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NAL2 1.46e-44 147 46 2 175 3 rplJ Large ribosomal subunit protein uL10 Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KD41 1.46e-44 147 46 2 175 3 rplJ Large ribosomal subunit protein uL10 Coxiella burnetii (strain Dugway 5J108-111)
B6J273 1.46e-44 147 46 2 175 3 rplJ Large ribosomal subunit protein uL10 Coxiella burnetii (strain CbuG_Q212)
B6J5C0 1.46e-44 147 46 2 175 3 rplJ Large ribosomal subunit protein uL10 Coxiella burnetii (strain CbuK_Q154)
Q6FF92 8.39e-44 145 46 2 166 3 rplJ Large ribosomal subunit protein uL10 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
P41192 9.82e-44 142 84 0 86 3 rplJ Large ribosomal subunit protein uL10 (Fragment) Serratia marcescens
Q5QWA7 1.94e-43 144 45 1 172 3 rplJ Large ribosomal subunit protein uL10 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q4FQH1 2.33e-42 142 48 1 175 3 rplJ Large ribosomal subunit protein uL10 Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q1Q8P7 5.12e-41 138 47 1 175 3 rplJ Large ribosomal subunit protein uL10 Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
A1AX77 6.39e-41 138 47 1 155 3 rplJ Large ribosomal subunit protein uL10 Ruthia magnifica subsp. Calyptogena magnifica
Q8RTJ3 1.54e-40 137 46 1 162 3 rplJ Large ribosomal subunit protein uL10 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RU91 1.54e-40 137 46 1 162 3 rplJ Large ribosomal subunit protein uL10 Xanthomonas campestris pv. campestris (strain B100)
Q4URD0 1.54e-40 137 46 1 162 3 rplJ Large ribosomal subunit protein uL10 Xanthomonas campestris pv. campestris (strain 8004)
A5EX72 3.93e-40 136 46 2 168 3 rplJ Large ribosomal subunit protein uL10 Dichelobacter nodosus (strain VCS1703A)
Q1H4P6 4.72e-40 136 45 2 175 3 rplJ Large ribosomal subunit protein uL10 Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q5GWS4 6.84e-40 135 46 1 162 3 rplJ Large ribosomal subunit protein uL10 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SQP9 6.84e-40 135 46 1 162 3 rplJ Large ribosomal subunit protein uL10 Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2NZX6 6.84e-40 135 46 1 162 3 rplJ Large ribosomal subunit protein uL10 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q3BWZ3 9.68e-40 135 46 1 162 3 rplJ Large ribosomal subunit protein uL10 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8PNT2 9.68e-40 135 46 1 162 3 rplJ Large ribosomal subunit protein uL10 Xanthomonas axonopodis pv. citri (strain 306)
Q60A08 1.27e-39 135 49 1 175 3 rplJ Large ribosomal subunit protein uL10 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q15YB3 1.91e-39 134 49 1 155 3 rplJ Large ribosomal subunit protein uL10 Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q7VRP5 6.77e-39 132 39 0 161 3 rplJ Large ribosomal subunit protein uL10 Blochmanniella floridana
A5CW27 1.82e-37 129 43 1 155 3 rplJ Large ribosomal subunit protein uL10 Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
B2FQ36 2e-37 129 48 0 145 3 rplJ Large ribosomal subunit protein uL10 Stenotrophomonas maltophilia (strain K279a)
B4SKV4 2.99e-37 129 45 1 162 3 rplJ Large ribosomal subunit protein uL10 Stenotrophomonas maltophilia (strain R551-3)
Q3J8Q5 3.52e-35 124 43 2 175 3 rplJ Large ribosomal subunit protein uL10 Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q7NQE4 3.64e-35 123 43 3 166 3 rplJ Large ribosomal subunit protein uL10 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q47JB2 4.75e-35 123 42 2 165 3 rplJ Large ribosomal subunit protein uL10 Dechloromonas aromatica (strain RCB)
Q5P341 1.53e-33 119 41 2 163 3 rplJ Large ribosomal subunit protein uL10 Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
C1DAQ8 1.82e-33 119 40 2 162 3 rplJ Large ribosomal subunit protein uL10 Laribacter hongkongensis (strain HLHK9)
Q8XUZ6 1.09e-32 117 40 2 164 3 rplJ Large ribosomal subunit protein uL10 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q2YB07 1.33e-32 117 38 2 175 3 rplJ Large ribosomal subunit protein uL10 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q1BRT8 1.86e-32 116 40 2 164 3 rplJ Large ribosomal subunit protein uL10 Burkholderia orbicola (strain AU 1054)
B1JU12 1.86e-32 116 40 2 164 3 rplJ Large ribosomal subunit protein uL10 Burkholderia orbicola (strain MC0-3)
A0K3L5 1.86e-32 116 40 2 164 3 rplJ Large ribosomal subunit protein uL10 Burkholderia cenocepacia (strain HI2424)
Q058E3 1.95e-32 116 36 0 158 3 rplJ Large ribosomal subunit protein uL10 Buchnera aphidicola subsp. Cinara cedri (strain Cc)
A9IJ29 4.18e-32 115 39 2 175 3 rplJ Large ribosomal subunit protein uL10 Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
B4E5B0 4.42e-32 115 40 2 164 3 rplJ Large ribosomal subunit protein uL10 Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
B1HMZ9 7.08e-32 115 40 1 163 3 rplJ Large ribosomal subunit protein uL10 Lysinibacillus sphaericus (strain C3-41)
Q7W0S1 7.26e-32 115 39 2 175 3 rplJ Large ribosomal subunit protein uL10 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W2H1 7.26e-32 115 39 2 175 3 rplJ Large ribosomal subunit protein uL10 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WRE1 7.26e-32 115 39 2 175 3 rplJ Large ribosomal subunit protein uL10 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
B0U5X9 1.01e-31 115 42 0 145 3 rplJ Large ribosomal subunit protein uL10 Xylella fastidiosa (strain M12)
Q39KH7 1.69e-31 114 40 2 164 3 rplJ Large ribosomal subunit protein uL10 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
B2JIH6 1.91e-31 114 40 2 163 3 rplJ Large ribosomal subunit protein uL10 Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q0K604 2.06e-31 114 40 1 149 3 rplJ Large ribosomal subunit protein uL10 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q87A30 3.08e-31 113 40 1 162 3 rplJ Large ribosomal subunit protein uL10 Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2IA70 3.08e-31 113 40 1 162 3 rplJ Large ribosomal subunit protein uL10 Xylella fastidiosa (strain M23)
B3R7T8 4.6e-31 113 40 1 149 3 rplJ Large ribosomal subunit protein uL10 Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q9PA84 6.43e-31 112 42 0 145 3 rplJ Large ribosomal subunit protein uL10 Xylella fastidiosa (strain 9a5c)
Q46WD2 7.4e-31 112 39 2 162 3 rplJ Large ribosomal subunit protein uL10 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q82T73 1.08e-30 112 40 2 172 3 rplJ Large ribosomal subunit protein uL10 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
B1XSP1 1.4e-30 112 39 1 143 3 rplJ Large ribosomal subunit protein uL10 Polynucleobacter necessarius subsp. necessarius (strain STIR1)
A7Z0M6 2.27e-30 111 38 2 167 3 rplJ Large ribosomal subunit protein uL10 Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q1LI18 3.71e-30 110 40 1 149 3 rplJ Large ribosomal subunit protein uL10 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
B2UEN8 4.11e-30 110 39 2 158 3 rplJ Large ribosomal subunit protein uL10 Ralstonia pickettii (strain 12J)
Q6GBU8 4.53e-30 110 36 1 163 3 rplJ Large ribosomal subunit protein uL10 Staphylococcus aureus (strain MSSA476)
P66049 5.27e-30 110 36 1 163 3 rplJ Large ribosomal subunit protein uL10 Staphylococcus aureus (strain MW2)
A8YZN7 5.27e-30 110 36 1 163 3 rplJ Large ribosomal subunit protein uL10 Staphylococcus aureus (strain USA300 / TCH1516)
Q6GJC9 5.27e-30 110 36 1 163 3 rplJ Large ribosomal subunit protein uL10 Staphylococcus aureus (strain MRSA252)
P99155 5.27e-30 110 36 1 163 1 rplJ Large ribosomal subunit protein uL10 Staphylococcus aureus (strain N315)
P66048 5.27e-30 110 36 1 163 3 rplJ Large ribosomal subunit protein uL10 Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QEJ1 5.27e-30 110 36 1 163 3 rplJ Large ribosomal subunit protein uL10 Staphylococcus aureus (strain Newman)
Q5HID6 5.27e-30 110 36 1 163 3 rplJ Large ribosomal subunit protein uL10 Staphylococcus aureus (strain COL)
Q2YSC2 5.27e-30 110 36 1 163 3 rplJ Large ribosomal subunit protein uL10 Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5IQ93 5.27e-30 110 36 1 163 3 rplJ Large ribosomal subunit protein uL10 Staphylococcus aureus (strain JH9)
Q2G0N9 5.27e-30 110 36 1 163 3 rplJ Large ribosomal subunit protein uL10 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FJA1 5.27e-30 110 36 1 163 3 rplJ Large ribosomal subunit protein uL10 Staphylococcus aureus (strain USA300)
A6TZ16 5.27e-30 110 36 1 163 3 rplJ Large ribosomal subunit protein uL10 Staphylococcus aureus (strain JH1)
A7WYW2 5.27e-30 110 36 1 163 3 rplJ Large ribosomal subunit protein uL10 Staphylococcus aureus (strain Mu3 / ATCC 700698)
A1KB36 6.23e-30 110 40 1 144 3 rplJ Large ribosomal subunit protein uL10 Azoarcus sp. (strain BH72)
A9VNB2 7.53e-30 109 38 1 163 3 rplJ Large ribosomal subunit protein uL10 Bacillus mycoides (strain KBAB4)
A2SLG7 1.25e-29 109 40 4 163 3 rplJ Large ribosomal subunit protein uL10 Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
Q8DZ20 1.79e-29 108 40 0 130 3 rplJ Large ribosomal subunit protein uL10 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
B4U3I0 1.89e-29 108 42 0 130 3 rplJ Large ribosomal subunit protein uL10 Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
Q1WST4 1.98e-29 108 43 0 137 3 rplJ Large ribosomal subunit protein uL10 Ligilactobacillus salivarius (strain UCC118)
B5XLE2 2.08e-29 108 40 1 151 3 rplJ Large ribosomal subunit protein uL10 Streptococcus pyogenes serotype M49 (strain NZ131)
P0DD99 2.08e-29 108 40 1 151 3 rplJ Large ribosomal subunit protein uL10 Streptococcus pyogenes serotype M3 (strain SSI-1)
Q48TS4 2.08e-29 108 40 1 151 3 rplJ Large ribosomal subunit protein uL10 Streptococcus pyogenes serotype M28 (strain MGAS6180)
A2REM5 2.08e-29 108 40 1 151 3 rplJ Large ribosomal subunit protein uL10 Streptococcus pyogenes serotype M5 (strain Manfredo)
Q5XCB5 2.08e-29 108 40 1 151 1 rplJ Large ribosomal subunit protein uL10 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DD98 2.08e-29 108 40 1 151 3 rplJ Large ribosomal subunit protein uL10 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
C5D3Q6 2.27e-29 108 40 0 144 3 rplJ Large ribosomal subunit protein uL10 Geobacillus sp. (strain WCH70)
Q03E50 2.32e-29 108 43 0 132 3 rplJ Large ribosomal subunit protein uL10 Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
Q0AF51 2.36e-29 108 40 2 155 3 rplJ Large ribosomal subunit protein uL10 Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q38V10 2.41e-29 108 43 0 137 3 rplJ Large ribosomal subunit protein uL10 Latilactobacillus sakei subsp. sakei (strain 23K)
Q81J51 2.82e-29 108 37 1 163 3 rplJ Large ribosomal subunit protein uL10 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q8E4M6 3.07e-29 108 40 0 130 3 rplJ Large ribosomal subunit protein uL10 Streptococcus agalactiae serotype III (strain NEM316)
Q3K0K8 3.07e-29 108 40 0 130 3 rplJ Large ribosomal subunit protein uL10 Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
P68900 3.14e-29 108 42 0 130 3 rplJ Large ribosomal subunit protein uL10 Streptococcus pyogenes serotype M1
Q6HPR9 3.24e-29 108 37 1 163 3 rplJ Large ribosomal subunit protein uL10 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q63HA1 3.24e-29 108 37 1 163 3 rplJ Large ribosomal subunit protein uL10 Bacillus cereus (strain ZK / E33L)
B9IZI3 3.24e-29 108 37 1 163 3 rplJ Large ribosomal subunit protein uL10 Bacillus cereus (strain Q1)
B7HQT3 3.24e-29 108 37 1 163 3 rplJ Large ribosomal subunit protein uL10 Bacillus cereus (strain AH187)
B7HJ37 3.24e-29 108 37 1 163 3 rplJ Large ribosomal subunit protein uL10 Bacillus cereus (strain B4264)
C1ET28 3.24e-29 108 37 1 163 3 rplJ Large ribosomal subunit protein uL10 Bacillus cereus (strain 03BB102)
Q73FA7 3.24e-29 108 37 1 163 3 rplJ Large ribosomal subunit protein uL10 Bacillus cereus (strain ATCC 10987 / NRS 248)
B7JKA7 3.24e-29 108 37 1 163 3 rplJ Large ribosomal subunit protein uL10 Bacillus cereus (strain AH820)
Q81VU1 3.24e-29 108 37 1 163 3 rplJ Large ribosomal subunit protein uL10 Bacillus anthracis
C3LJ71 3.24e-29 108 37 1 163 3 rplJ Large ribosomal subunit protein uL10 Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P9P4 3.24e-29 108 37 1 163 3 rplJ Large ribosomal subunit protein uL10 Bacillus anthracis (strain A0248)
A5GAX9 3.31e-29 108 37 3 174 3 rplJ Large ribosomal subunit protein uL10 Geotalea uraniireducens (strain Rf4)
Q8P159 3.86e-29 108 40 1 151 3 rplJ Large ribosomal subunit protein uL10 Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5L419 4.59e-29 107 38 0 144 3 rplJ Large ribosomal subunit protein uL10 Geobacillus kaustophilus (strain HTA426)
C6E4R6 4.7e-29 108 38 2 173 3 rplJ Large ribosomal subunit protein uL10 Geobacter sp. (strain M21)
B5EFP1 4.7e-29 108 38 2 173 3 rplJ Large ribosomal subunit protein uL10 Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
A8F972 5.88e-29 107 37 1 163 3 rplJ Large ribosomal subunit protein uL10 Bacillus pumilus (strain SAFR-032)
P66042 6.77e-29 107 38 1 164 3 rplJ Large ribosomal subunit protein uL10 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
P66043 6.77e-29 107 38 1 164 3 rplJ Large ribosomal subunit protein uL10 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q3A6Q6 7.06e-29 107 32 1 167 3 rplJ Large ribosomal subunit protein uL10 Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
P42923 7.96e-29 107 37 2 167 1 rplJ Large ribosomal subunit protein uL10 Bacillus subtilis (strain 168)
Q03ST7 8.77e-29 107 42 0 133 3 rplJ Large ribosomal subunit protein uL10 Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
A0AF49 9.16e-29 107 38 1 164 3 rplJ Large ribosomal subunit protein uL10 Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
B8DF05 9.16e-29 107 38 1 164 3 rplJ Large ribosomal subunit protein uL10 Listeria monocytogenes serotype 4a (strain HCC23)
Q724G2 9.16e-29 107 38 1 164 3 rplJ Large ribosomal subunit protein uL10 Listeria monocytogenes serotype 4b (strain F2365)
C1KYI2 9.16e-29 107 38 1 164 3 rplJ Large ribosomal subunit protein uL10 Listeria monocytogenes serotype 4b (strain CLIP80459)
B7IT08 1.23e-28 106 36 1 163 3 rplJ Large ribosomal subunit protein uL10 Bacillus cereus (strain G9842)
Q39Y15 1.35e-28 107 38 2 172 3 rplJ Large ribosomal subunit protein uL10 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q748Y4 2.29e-28 106 38 2 172 3 rplJ Large ribosomal subunit protein uL10 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
B2G5T6 2.42e-28 105 36 1 158 3 rplJ Large ribosomal subunit protein uL10 Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VIA9 2.42e-28 105 36 1 158 3 rplJ Large ribosomal subunit protein uL10 Limosilactobacillus reuteri (strain DSM 20016)
A4IJH8 2.48e-28 105 37 0 144 3 rplJ Large ribosomal subunit protein uL10 Geobacillus thermodenitrificans (strain NG80-2)
B9M6V4 3.06e-28 105 37 3 174 3 rplJ Large ribosomal subunit protein uL10 Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
Q65PB8 3.28e-28 105 36 1 163 3 rplJ Large ribosomal subunit protein uL10 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
B9DU77 4.07e-28 105 42 0 130 3 rplJ Large ribosomal subunit protein uL10 Streptococcus uberis (strain ATCC BAA-854 / 0140J)
A7GK10 5.57e-28 105 36 1 163 3 rplJ Large ribosomal subunit protein uL10 Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
A6TWJ2 7.53e-28 104 34 1 166 3 rplJ Large ribosomal subunit protein uL10 Alkaliphilus metalliredigens (strain QYMF)
Q9CG41 8.15e-28 104 43 0 123 3 rplJ Large ribosomal subunit protein uL10 Lactococcus lactis subsp. lactis (strain IL1403)
Q02YR7 8.79e-28 104 43 0 123 3 rplJ Large ribosomal subunit protein uL10 Lactococcus lactis subsp. cremoris (strain SK11)
A2RKI8 8.79e-28 104 43 0 123 3 rplJ Large ribosomal subunit protein uL10 Lactococcus lactis subsp. cremoris (strain MG1363)
Q8DUH2 9e-28 104 40 0 137 3 rplJ Large ribosomal subunit protein uL10 Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
B2GAC5 1.14e-27 104 40 1 140 3 rplJ Large ribosomal subunit protein uL10 Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
Q88YW8 1.88e-27 103 40 0 128 3 rplJ Large ribosomal subunit protein uL10 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q9KGE4 2.07e-27 103 38 1 159 3 rplJ Large ribosomal subunit protein uL10 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
B9E8Q8 2.16e-27 103 37 1 143 3 rplJ Large ribosomal subunit protein uL10 Macrococcus caseolyticus (strain JCSC5402)
Q8ETZ1 3.97e-27 102 35 1 159 3 rplJ Large ribosomal subunit protein uL10 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q890N3 4.22e-27 103 37 1 161 3 rplJ Large ribosomal subunit protein uL10 Clostridium tetani (strain Massachusetts / E88)
Q03LT2 4.26e-27 102 40 0 133 3 rplJ Large ribosomal subunit protein uL10 Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q5M5F2 4.26e-27 102 40 0 133 3 rplJ Large ribosomal subunit protein uL10 Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5M0W5 4.26e-27 102 40 0 133 3 rplJ Large ribosomal subunit protein uL10 Streptococcus thermophilus (strain CNRZ 1066)
A3CMW1 6.32e-27 102 39 1 158 3 rplJ Large ribosomal subunit protein uL10 Streptococcus sanguinis (strain SK36)
A8AXG9 7.2e-27 102 39 1 158 3 rplJ Large ribosomal subunit protein uL10 Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
B5ELX0 8.45e-27 102 37 2 174 3 rplJ Large ribosomal subunit protein uL10 Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J457 8.45e-27 102 37 2 174 3 rplJ Large ribosomal subunit protein uL10 Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
A1KRG4 9.22e-27 102 38 2 162 3 rplJ Large ribosomal subunit protein uL10 Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
P66047 9.22e-27 102 38 2 162 3 rplJ Large ribosomal subunit protein uL10 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P66046 9.22e-27 102 38 2 162 3 rplJ Large ribosomal subunit protein uL10 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q5F5R3 1.47e-26 101 38 2 162 3 rplJ Large ribosomal subunit protein uL10 Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q8CTT2 2.01e-26 101 34 1 163 3 rplJ Large ribosomal subunit protein uL10 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HRL3 2.01e-26 101 34 1 163 3 rplJ Large ribosomal subunit protein uL10 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
C1CR00 2.14e-26 100 40 0 137 3 rplJ Large ribosomal subunit protein uL10 Streptococcus pneumoniae (strain Taiwan19F-14)
C1CL63 2.14e-26 100 40 0 137 3 rplJ Large ribosomal subunit protein uL10 Streptococcus pneumoniae (strain P1031)
C1CEU4 2.14e-26 100 40 0 137 3 rplJ Large ribosomal subunit protein uL10 Streptococcus pneumoniae (strain JJA)
P66051 2.14e-26 100 40 0 137 3 rplJ Large ribosomal subunit protein uL10 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P66050 2.14e-26 100 40 0 137 3 rplJ Large ribosomal subunit protein uL10 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
B8ZKK4 2.14e-26 100 40 0 137 3 rplJ Large ribosomal subunit protein uL10 Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
B1ICF5 2.14e-26 100 40 0 137 3 rplJ Large ribosomal subunit protein uL10 Streptococcus pneumoniae (strain Hungary19A-6)
Q04JZ3 2.14e-26 100 40 0 137 3 rplJ Large ribosomal subunit protein uL10 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
B9DKX2 2.19e-26 100 34 0 144 3 rplJ Large ribosomal subunit protein uL10 Staphylococcus carnosus (strain TM300)
A1ALT2 2.29e-26 101 36 3 172 3 rplJ Large ribosomal subunit protein uL10 Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
Q4L3K0 3.67e-26 100 34 1 163 3 rplJ Large ribosomal subunit protein uL10 Staphylococcus haemolyticus (strain JCSC1435)
Q8XHR6 4.01e-26 100 36 1 160 3 rplJ Large ribosomal subunit protein uL10 Clostridium perfringens (strain 13 / Type A)
A1VTG0 4.06e-26 100 40 3 166 3 rplJ Large ribosomal subunit protein uL10 Polaromonas naphthalenivorans (strain CJ2)
Q21SF5 4.3e-26 100 36 2 165 3 rplJ Large ribosomal subunit protein uL10 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
C5CKF1 7.17e-26 100 37 2 162 3 rplJ Large ribosomal subunit protein uL10 Variovorax paradoxus (strain S110)
Q49V49 9e-26 99 36 0 130 3 rplJ Large ribosomal subunit protein uL10 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
C1C7V5 1.15e-25 99 41 0 125 3 rplJ Large ribosomal subunit protein uL10 Streptococcus pneumoniae (strain 70585)
B8FEU3 1.36e-25 99 34 1 170 3 rplJ Large ribosomal subunit protein uL10 Desulfatibacillum aliphaticivorans
B5E5F1 1.85e-25 98 40 0 137 3 rplJ Large ribosomal subunit protein uL10 Streptococcus pneumoniae serotype 19F (strain G54)
B8D0B4 2.51e-25 98 37 1 167 3 rplJ Large ribosomal subunit protein uL10 Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)
B1YRC0 2.89e-25 98 40 2 164 3 rplJ Large ribosomal subunit protein uL10 Burkholderia ambifaria (strain MC40-6)
Q2JFI7 2.94e-25 98 37 2 168 3 rplJ Large ribosomal subunit protein uL10 Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
Q92QH9 2.98e-25 98 39 2 169 3 rplJ Large ribosomal subunit protein uL10 Rhizobium meliloti (strain 1021)
Q03ZH4 4.73e-25 97 39 0 133 3 rplJ Large ribosomal subunit protein uL10 Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
B1MVU2 5.46e-25 97 37 0 133 3 rplJ Large ribosomal subunit protein uL10 Leuconostoc citreum (strain KM20)
Q5WLS3 5.92e-25 97 37 1 163 3 rplJ Large ribosomal subunit protein uL10 Shouchella clausii (strain KSM-K16)
A9ADI3 5.96e-25 97 40 2 164 3 rplJ Large ribosomal subunit protein uL10 Burkholderia multivorans (strain ATCC 17616 / 249)
A6T3L5 9.04e-25 97 37 1 143 3 rplJ Large ribosomal subunit protein uL10 Janthinobacterium sp. (strain Marseille)
A8MLD0 9.14e-25 97 34 2 163 3 rplJ Large ribosomal subunit protein uL10 Alkaliphilus oremlandii (strain OhILAs)
A4G9U7 9.33e-25 97 38 1 143 3 rplJ Large ribosomal subunit protein uL10 Herminiimonas arsenicoxydans
Q97EG7 1.07e-24 96 35 1 161 3 rplJ Large ribosomal subunit protein uL10 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q2SU17 1.46e-24 96 39 2 164 3 rplJ Large ribosomal subunit protein uL10 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63Q01 1.64e-24 96 39 2 164 3 rplJ Large ribosomal subunit protein uL10 Burkholderia pseudomallei (strain K96243)
Q3JMQ1 1.64e-24 96 39 2 164 3 rplJ Large ribosomal subunit protein uL10 Burkholderia pseudomallei (strain 1710b)
Q62GJ5 1.64e-24 96 39 2 164 3 rplJ Large ribosomal subunit protein uL10 Burkholderia mallei (strain ATCC 23344)
A2S7G4 1.64e-24 96 39 2 164 3 rplJ Large ribosomal subunit protein uL10 Burkholderia mallei (strain NCTC 10229)
Q123G1 1.65e-24 96 38 2 151 3 rplJ Large ribosomal subunit protein uL10 Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q035V5 2.15e-24 95 35 1 160 3 rplJ Large ribosomal subunit protein uL10 Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
B3WA02 2.15e-24 95 35 1 160 3 rplJ Large ribosomal subunit protein uL10 Lacticaseibacillus casei (strain BL23)
Q0RRT3 2.18e-24 96 36 2 166 3 rplJ Large ribosomal subunit protein uL10 Frankia alni (strain DSM 45986 / CECT 9034 / ACN14a)
Q3A9Q4 2.41e-24 95 32 1 168 3 rplJ Large ribosomal subunit protein uL10 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q830Q7 3.85e-24 95 35 0 137 3 rplJ Large ribosomal subunit protein uL10 Enterococcus faecalis (strain ATCC 700802 / V583)
A7HCH9 8.68e-24 94 33 1 171 3 rplJ Large ribosomal subunit protein uL10 Anaeromyxobacter sp. (strain Fw109-5)
Q18CE8 9.78e-24 94 35 1 141 3 rplJ Large ribosomal subunit protein uL10 Clostridioides difficile (strain 630)
Q13TG0 1.02e-23 94 37 2 141 3 rplJ Large ribosomal subunit protein uL10 Paraburkholderia xenovorans (strain LB400)
B2T761 1.02e-23 94 37 2 141 3 rplJ Large ribosomal subunit protein uL10 Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q6AP80 1.24e-23 94 33 2 172 3 rplJ Large ribosomal subunit protein uL10 Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q3SLQ8 2.7e-23 93 37 2 144 3 rplJ Large ribosomal subunit protein uL10 Thiobacillus denitrificans (strain ATCC 25259)
B8JB72 3.15e-23 93 33 1 171 3 rplJ Large ribosomal subunit protein uL10 Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
B4UDT4 3.74e-23 92 33 1 171 3 rplJ Large ribosomal subunit protein uL10 Anaeromyxobacter sp. (strain K)
C1AYX3 4.68e-23 93 38 1 138 3 rplJ Large ribosomal subunit protein uL10 Rhodococcus opacus (strain B4)
Q0SF99 4.68e-23 93 38 1 138 3 rplJ Large ribosomal subunit protein uL10 Rhodococcus jostii (strain RHA1)
C0ZV33 7.14e-23 92 38 1 138 3 rplJ Large ribosomal subunit protein uL10 Rhodococcus erythropolis (strain PR4 / NBRC 100887)
A1WCN1 8.76e-23 91 38 1 139 3 rplJ Large ribosomal subunit protein uL10 Acidovorax sp. (strain JS42)
B9MH49 8.76e-23 91 38 1 139 3 rplJ Large ribosomal subunit protein uL10 Acidovorax ebreus (strain TPSY)
Q2RFN7 8.97e-23 92 32 1 167 3 rplJ Large ribosomal subunit protein uL10 Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q2II80 1.06e-22 91 35 1 151 3 rplJ Large ribosomal subunit protein uL10 Anaeromyxobacter dehalogenans (strain 2CP-C)
Q5YPC7 1.55e-22 91 36 2 168 3 rplJ Large ribosomal subunit protein uL10 Nocardia farcinica (strain IFM 10152)
A9BR96 1.6e-22 91 38 1 139 3 rplJ Large ribosomal subunit protein uL10 Delftia acidovorans (strain DSM 14801 / SPH-1)
B3E7S6 1.77e-22 91 35 2 168 3 rplJ Large ribosomal subunit protein uL10 Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
Q98QS1 2.04e-22 90 34 0 140 3 rplJ Large ribosomal subunit protein uL10 Mycoplasmopsis pulmonis (strain UAB CTIP)
B9JVM6 2.88e-22 90 36 2 169 3 rplJ Large ribosomal subunit protein uL10 Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
B9KYX5 3.23e-22 90 33 0 138 3 rplJ Large ribosomal subunit protein uL10 Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2)
A1TVT2 3.24e-22 90 38 1 139 3 rplJ Large ribosomal subunit protein uL10 Paracidovorax citrulli (strain AAC00-1)
Q8UE06 6.51e-22 89 36 2 169 1 rplJ Large ribosomal subunit protein uL10 Agrobacterium fabrum (strain C58 / ATCC 33970)
B2A4C8 6.72e-22 89 31 1 170 3 rplJ Large ribosomal subunit protein uL10 Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
Q6AH11 7.49e-22 89 32 2 171 3 rplJ Large ribosomal subunit protein uL10 Leifsonia xyli subsp. xyli (strain CTCB07)
B8DLM5 1.23e-21 89 35 0 141 3 rplJ Large ribosomal subunit protein uL10 Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
B3PW57 2.14e-21 88 35 2 169 3 rplJ Large ribosomal subunit protein uL10 Rhizobium etli (strain CIAT 652)
Q30X08 2.39e-21 88 34 2 169 3 rplJ Large ribosomal subunit protein uL10 Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q2K9M6 2.49e-21 88 34 2 169 3 rplJ Large ribosomal subunit protein uL10 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
B5ZYS5 2.68e-21 88 36 2 169 3 rplJ Large ribosomal subunit protein uL10 Rhizobium leguminosarum bv. trifolii (strain WSM2304)
A8HTY1 3.28e-21 87 36 2 169 3 rplJ Large ribosomal subunit protein uL10 Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
A1USC6 3.35e-21 87 32 2 173 3 rplJ Large ribosomal subunit protein uL10 Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
A4FPQ7 3.58e-21 87 36 1 138 3 rplJ Large ribosomal subunit protein uL10 Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
Q1D7U5 5.21e-21 87 37 2 156 3 rplJ Large ribosomal subunit protein uL10 Myxococcus xanthus (strain DK1622)
Q2RQV1 5.37e-21 87 34 2 173 3 rplJ Large ribosomal subunit protein uL10 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q6G3X7 5.73e-21 87 32 2 173 3 rplJ Large ribosomal subunit protein uL10 Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
B9JDR9 6.31e-21 87 34 2 169 3 rplJ Large ribosomal subunit protein uL10 Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
A9GRA5 9.24e-21 86 35 3 153 3 rplJ Large ribosomal subunit protein uL10 Sorangium cellulosum (strain So ce56)
P36257 9.38e-21 87 34 2 167 3 rplJ Large ribosomal subunit protein uL10 Streptomyces griseus
B1W444 9.38e-21 87 34 2 167 3 rplJ Large ribosomal subunit protein uL10 Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
Q1MIF1 9.67e-21 86 35 2 169 3 rplJ Large ribosomal subunit protein uL10 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q8R7U4 1.33e-20 86 30 3 176 3 rplJ Large ribosomal subunit protein uL10 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
A6X0A7 1.36e-20 86 33 2 169 3 rplJ Large ribosomal subunit protein uL10 Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q2LQ89 1.38e-20 86 33 1 151 3 rplJ Large ribosomal subunit protein uL10 Syntrophus aciditrophicus (strain SB)
B6IRP4 1.9e-20 85 33 2 168 3 rplJ Large ribosomal subunit protein uL10 Rhodospirillum centenum (strain ATCC 51521 / SW)
B1MH70 1.99e-20 85 34 2 166 3 rplJ Large ribosomal subunit protein uL10 Mycobacteroides abscessus (strain ATCC 19977 / DSM 44196 / CCUG 20993 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543 / L948)
A8LC66 2.06e-20 85 34 3 170 3 rplJ Large ribosomal subunit protein uL10 Parafrankia sp. (strain EAN1pec)
Q11HB1 2.48e-20 85 34 2 169 3 rplJ Large ribosomal subunit protein uL10 Chelativorans sp. (strain BNC1)
Q98N68 2.64e-20 85 36 2 169 3 rplJ Large ribosomal subunit protein uL10 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q8YHP9 3.04e-20 85 33 2 169 3 rplJ Large ribosomal subunit protein uL10 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RJL3 3.04e-20 85 33 2 169 3 rplJ Large ribosomal subunit protein uL10 Brucella melitensis biotype 2 (strain ATCC 23457)
A9M5R2 3.04e-20 85 33 2 169 3 rplJ Large ribosomal subunit protein uL10 Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q2YM13 3.04e-20 85 33 2 169 3 rplJ Large ribosomal subunit protein uL10 Brucella abortus (strain 2308)
B2S689 3.04e-20 85 33 2 169 3 rplJ Large ribosomal subunit protein uL10 Brucella abortus (strain S19)
A1WK53 3.36e-20 85 37 1 139 3 rplJ Large ribosomal subunit protein uL10 Verminephrobacter eiseniae (strain EF01-2)
B0S064 4.02e-20 85 32 0 140 3 rplJ Large ribosomal subunit protein uL10 Finegoldia magna (strain ATCC 29328 / DSM 20472 / WAL 2508)
P41107 4.18e-20 85 33 2 169 3 rplJ Large ribosomal subunit protein uL10 Brucella abortus biovar 1 (strain 9-941)
B0KCJ0 5.17e-20 84 34 2 141 3 rplJ Large ribosomal subunit protein uL10 Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
B0CH43 7.53e-20 84 33 2 169 3 rplJ Large ribosomal subunit protein uL10 Brucella suis (strain ATCC 23445 / NCTC 10510)
B0K5G6 8.18e-20 84 34 2 141 3 rplJ Large ribosomal subunit protein uL10 Thermoanaerobacter sp. (strain X514)
Q04E44 1.18e-19 84 35 0 133 3 rplJ Large ribosomal subunit protein uL10 Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
A7IKP8 1.2e-19 84 35 2 168 3 rplJ Large ribosomal subunit protein uL10 Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
A9ISF5 1.28e-19 83 32 2 173 3 rplJ Large ribosomal subunit protein uL10 Bartonella tribocorum (strain CIP 105476 / IBS 506)
Q6FZL7 1.54e-19 83 32 2 173 3 rplJ Large ribosomal subunit protein uL10 Bartonella quintana (strain Toulouse)
Q82DQ7 1.6e-19 83 33 2 166 3 rplJ Large ribosomal subunit protein uL10 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q048U4 1.7e-19 83 34 1 139 3 rplJ Large ribosomal subunit protein uL10 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q1G904 1.7e-19 83 34 1 139 3 rplJ Large ribosomal subunit protein uL10 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
Q67JT1 1.71e-19 83 35 1 140 3 rplJ Large ribosomal subunit protein uL10 Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q1MPU2 1.87e-19 83 33 0 141 3 rplJ Large ribosomal subunit protein uL10 Lawsonia intracellularis (strain PHE/MN1-00)
P41191 2.03e-19 83 29 2 173 3 rplJ Large ribosomal subunit protein uL10 Liberibacter africanus
A5D5H8 2.53e-19 83 34 2 172 3 rplJ Large ribosomal subunit protein uL10 Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
Q73SE9 2.75e-19 83 33 2 168 3 rplJ Large ribosomal subunit protein uL10 Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QL54 2.81e-19 83 33 2 168 3 rplJ Large ribosomal subunit protein uL10 Mycobacterium avium (strain 104)
Q2W2H9 3.24e-19 82 36 2 149 3 rplJ Large ribosomal subunit protein uL10 Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q8G067 3.89e-19 82 33 2 169 3 rplJ Large ribosomal subunit protein uL10 Brucella suis biovar 1 (strain 1330)
A0LII2 5.91e-19 82 31 1 173 3 rplJ Large ribosomal subunit protein uL10 Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
Q727C9 6.43e-19 82 34 0 141 3 rplJ Large ribosomal subunit protein uL10 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
B1Y7H5 7.06e-19 82 35 2 162 3 rplJ Large ribosomal subunit protein uL10 Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
Q73JJ5 7.09e-19 82 35 2 158 3 rplJ Large ribosomal subunit protein uL10 Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
P9WHE7 8.53e-19 81 33 2 166 1 rplJ Large ribosomal subunit protein uL10 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WHE6 8.53e-19 81 33 2 166 3 rplJ Large ribosomal subunit protein uL10 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U036 8.53e-19 81 33 2 166 3 rplJ Large ribosomal subunit protein uL10 Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1AKY4 8.53e-19 81 33 2 166 3 rplJ Large ribosomal subunit protein uL10 Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KGD1 8.53e-19 81 33 2 166 3 rplJ Large ribosomal subunit protein uL10 Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P66045 8.53e-19 81 33 2 166 3 rplJ Large ribosomal subunit protein uL10 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
B8J1A6 9.06e-19 81 33 0 137 3 rplJ Large ribosomal subunit protein uL10 Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
B0UHX8 1.1e-18 81 34 2 163 3 rplJ Large ribosomal subunit protein uL10 Methylobacterium sp. (strain 4-46)
A8G2K9 1.16e-18 81 30 1 140 3 rplJ Large ribosomal subunit protein uL10 Prochlorococcus marinus (strain MIT 9215)
A5VC07 1.23e-18 81 32 2 167 3 rplJ Large ribosomal subunit protein uL10 Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
P29343 1.7e-18 80 33 2 163 3 rplJ Large ribosomal subunit protein uL10 Streptomyces antibioticus
B3QYL2 1.85e-18 80 29 1 148 3 rplJ Large ribosomal subunit protein uL10 Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
A7HWQ2 1.91e-18 80 32 2 169 3 rplJ Large ribosomal subunit protein uL10 Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
Q74L09 2.44e-18 80 32 1 139 3 rplJ Large ribosomal subunit protein uL10 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
C6C177 3.81e-18 80 32 1 173 3 rplJ Large ribosomal subunit protein uL10 Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
B2S2I6 9.23e-18 79 34 3 143 3 rplJ Large ribosomal subunit protein uL10 Treponema pallidum subsp. pallidum (strain SS14)
O83267 9.23e-18 79 34 3 143 3 rplJ Large ribosomal subunit protein uL10 Treponema pallidum (strain Nichols)
B1ZGR8 1.38e-17 78 36 2 150 3 rplJ Large ribosomal subunit protein uL10 Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
Q31CX9 1.52e-17 78 29 1 140 3 rplJ Large ribosomal subunit protein uL10 Prochlorococcus marinus (strain MIT 9312)
P41103 1.54e-17 78 31 2 167 3 rplJ Large ribosomal subunit protein uL10 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q9CBK7 1.55e-17 78 31 2 166 3 rplJ Large ribosomal subunit protein uL10 Mycobacterium leprae (strain TN)
B8ZSD0 1.55e-17 78 31 2 166 3 rplJ Large ribosomal subunit protein uL10 Mycobacterium leprae (strain Br4923)
B8IS75 1.67e-17 78 36 2 146 3 rplJ Large ribosomal subunit protein uL10 Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
A3PAS0 1.9e-17 78 29 1 140 3 rplJ Large ribosomal subunit protein uL10 Prochlorococcus marinus (strain MIT 9301)
B1LY45 1.96e-17 78 36 2 150 3 rplJ Large ribosomal subunit protein uL10 Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
Q3Z7T5 2.04e-17 78 30 2 151 3 rplJ Large ribosomal subunit protein uL10 Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195)
Q7V383 2.23e-17 77 28 1 140 3 rplJ Large ribosomal subunit protein uL10 Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
Q1GK51 2.42e-17 77 33 1 136 3 rplJ Large ribosomal subunit protein uL10 Ruegeria sp. (strain TM1040)
A2BNZ7 2.78e-17 77 29 1 140 3 rplJ Large ribosomal subunit protein uL10 Prochlorococcus marinus (strain AS9601)
Q6NJG6 3.66e-17 77 34 2 151 3 rplJ Large ribosomal subunit protein uL10 Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
Q3ATP7 3.94e-17 77 36 1 132 3 rplJ Large ribosomal subunit protein uL10 Chlorobium chlorochromatii (strain CaD3)
A4YSH9 4.25e-17 77 33 2 168 3 rplJ Large ribosomal subunit protein uL10 Bradyrhizobium sp. (strain ORS 278)
A5ELN9 4.25e-17 77 33 2 168 3 rplJ Large ribosomal subunit protein uL10 Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
Q0ANP1 4.29e-17 77 36 2 144 3 rplJ Large ribosomal subunit protein uL10 Maricaulis maris (strain MCS10)
P36249 4.34e-17 77 30 2 159 3 rplJ Large ribosomal subunit protein uL10 Liberibacter asiaticus
Q2ST51 4.65e-17 77 34 0 127 3 rplJ Large ribosomal subunit protein uL10 Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
Q1IHH2 5.36e-17 77 33 1 157 3 rplJ Large ribosomal subunit protein uL10 Koribacter versatilis (strain Ellin345)
B5Y932 8.03e-17 76 30 1 169 3 rplJ Large ribosomal subunit protein uL10 Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / OCM 4 / BT)
Q89J72 9.3e-17 76 33 2 168 3 rplJ Large ribosomal subunit protein uL10 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
B8DVY4 1.05e-16 76 32 3 170 3 rplJ Large ribosomal subunit protein uL10 Bifidobacterium animalis subsp. lactis (strain AD011)
Q5FTX5 1.33e-16 76 30 2 172 3 rplJ Large ribosomal subunit protein uL10 Gluconobacter oxydans (strain 621H)
Q3ZXX9 1.35e-16 75 30 1 139 3 rplJ Large ribosomal subunit protein uL10 Dehalococcoides mccartyi (strain CBDB1)
A5FQR0 1.35e-16 75 30 1 139 3 rplJ Large ribosomal subunit protein uL10 Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1)
B1XJH0 1.53e-16 75 28 3 176 3 rplJ Large ribosomal subunit protein uL10 Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
C5C0K5 1.55e-16 75 34 2 166 3 rplJ Large ribosomal subunit protein uL10 Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / CCUG 43141 / JCM 11478 / NBRC 16432 / NCIMB 13614 / HKI 0122)
Q9L5W5 1.63e-16 75 30 2 159 3 rplJ Large ribosomal subunit protein uL10 Liberibacter africanus subsp. capensis
B4R8K3 1.82e-16 75 31 2 144 3 rplJ Large ribosomal subunit protein uL10 Phenylobacterium zucineum (strain HLK1)
B2IK53 2e-16 75 32 2 169 3 rplJ Large ribosomal subunit protein uL10 Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
A5FZX3 2.37e-16 75 33 3 165 3 rplJ Large ribosomal subunit protein uL10 Acidiphilium cryptum (strain JF-5)
Q6A6K4 2.52e-16 75 34 1 138 3 rplJ Large ribosomal subunit protein uL10 Cutibacterium acnes (strain DSM 16379 / KPA171202)
B0CAD1 2.66e-16 75 27 2 176 3 rplJ Large ribosomal subunit protein uL10 Acaryochloris marina (strain MBIC 11017)
Q7U3T8 2.66e-16 75 29 1 140 3 rplJ Large ribosomal subunit protein uL10 Parasynechococcus marenigrum (strain WH8102)
P48953 3.06e-16 75 32 2 158 3 rplJ Large ribosomal subunit protein uL10 Streptomyces virginiae
A9B5G7 3.29e-16 74 32 2 154 3 rplJ Large ribosomal subunit protein uL10 Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785 / 114-95)
A2BUH9 3.81e-16 74 27 1 140 3 rplJ Large ribosomal subunit protein uL10 Prochlorococcus marinus (strain MIT 9515)
Q68XN0 4.52e-16 74 29 2 151 3 rplJ Large ribosomal subunit protein uL10 Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q5NPK9 4.76e-16 74 38 2 142 3 rplJ Large ribosomal subunit protein uL10 Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q5FM13 4.82e-16 74 28 1 142 3 rplJ Large ribosomal subunit protein uL10 Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS14950
Feature type CDS
Gene rplJ
Product 50S ribosomal protein L10
Location 222118 - 222615 (strand: 1)
Length 498 (nucleotides) / 165 (amino acids)

Contig

Accession term accessions NZ_VXKB01000004 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 258164 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2287
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00466 Ribosomal protein L10

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0244 Translation, ribosomal structure and biogenesis (J) J Ribosomal protein L10

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02864 large subunit ribosomal protein L10 Ribosome -

Protein Sequence

MALNLQDKQAIVAEVSEVAKGALSTVVADSRGVTVDKMTGLRKACREANVTVRVVRNTLLRRAVEGTSSECLKDVFVGPTLIAFSHEHPGAAARLFKDFAKANPAFEIKAAAFEGEFIAAKDIDRLATLPTYDEAIARLMATMKEAAAGKLVRTLAALRDQKEAA

Flanking regions ( +/- flanking 50bp)

GAAGTGAGTTCCGGGGTTGTATACCCGGCTAAACCAGGAGCAAGAAGCTAATGGCATTAAATCTTCAAGACAAACAAGCGATTGTTGCTGAAGTCAGCGAAGTTGCCAAAGGCGCGCTGTCTACAGTTGTCGCGGATTCCCGTGGTGTGACTGTAGATAAAATGACCGGTCTGCGTAAAGCATGTCGCGAAGCTAATGTTACCGTACGCGTTGTACGTAACACCCTGCTGCGCCGTGCTGTTGAAGGTACCTCTTCTGAGTGCCTGAAAGACGTATTCGTCGGTCCTACCTTGATTGCATTTTCTCATGAACATCCGGGCGCTGCTGCTCGCCTGTTCAAAGATTTCGCGAAAGCGAACCCTGCATTCGAGATTAAAGCCGCAGCCTTTGAAGGTGAGTTCATTGCAGCGAAAGATATCGATCGCTTAGCAACACTCCCAACTTACGACGAAGCAATTGCACGCCTGATGGCAACCATGAAAGAAGCCGCTGCAGGCAAATTGGTTCGCACTCTGGCAGCGTTACGCGATCAGAAAGAAGCTGCTTAATCGCTCTTTCTTTTCTTCGTTGCTTTTTAACGTATAAACTTATTCTGAAT