Homologs in group_199

Help

8 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_11820 FBDBKF_11820 90.0 Morganella morganii S1 rhtB Threonine/homoserine/homoserine lactone efflux protein
EHELCC_14485 EHELCC_14485 90.0 Morganella morganii S2 rhtB Threonine/homoserine/homoserine lactone efflux protein
NLDBIP_15580 NLDBIP_15580 90.0 Morganella morganii S4 rhtB Threonine/homoserine/homoserine lactone efflux protein
LHKJJB_15030 LHKJJB_15030 90.0 Morganella morganii S3 rhtB Threonine/homoserine/homoserine lactone efflux protein
HKOGLL_14150 HKOGLL_14150 90.0 Morganella morganii S5 rhtB Threonine/homoserine/homoserine lactone efflux protein
PMI_RS04000 PMI_RS04000 17.4 Proteus mirabilis HI4320 - LysE family transporter
PMI_RS06140 PMI_RS06140 31.7 Proteus mirabilis HI4320 - LysE family transporter
PMI_RS13905 PMI_RS13905 63.0 Proteus mirabilis HI4320 - LysE family translocator

Distribution of the homologs in the orthogroup group_199

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_199

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q1R8F4 3.81e-16 76 30 3 193 3 eamB Cysteine/O-acetylserine efflux protein Escherichia coli (strain UTI89 / UPEC)
Q8FF11 3.81e-16 76 30 3 193 3 eamB Cysteine/O-acetylserine efflux protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TER0 3.81e-16 76 30 3 193 3 eamB Cysteine/O-acetylserine efflux protein Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AEA8 3.81e-16 76 30 3 193 3 eamB Cysteine/O-acetylserine efflux protein Escherichia coli O1:K1 / APEC
Q3YYT7 4.8e-16 75 30 3 193 3 eamB Cysteine/O-acetylserine efflux protein Shigella sonnei (strain Ss046)
P38101 4.8e-16 75 30 3 193 1 eamB Cysteine/O-acetylserine efflux protein Escherichia coli (strain K12)
A8A390 4.8e-16 75 30 3 193 3 eamB Cysteine/O-acetylserine efflux protein Escherichia coli O9:H4 (strain HS)
A7ZQ23 8.16e-16 75 30 3 193 3 eamB Cysteine/O-acetylserine efflux protein Escherichia coli O139:H28 (strain E24377A / ETEC)
Q83K22 8.78e-16 75 30 3 193 3 eamB Cysteine/O-acetylserine efflux protein Shigella flexneri
Q0T1S8 8.78e-16 75 30 3 193 3 eamB Cysteine/O-acetylserine efflux protein Shigella flexneri serotype 5b (strain 8401)
Q8ZMX5 1.43e-15 74 30 3 194 3 eamB Cysteine/O-acetylserine efflux protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q57L56 1.43e-15 74 30 3 194 3 eamB Cysteine/O-acetylserine efflux protein Salmonella choleraesuis (strain SC-B67)
Q8Z4J7 1.49e-15 74 30 3 194 3 eamB Cysteine/O-acetylserine efflux protein Salmonella typhi
Q5PNB4 1.49e-15 74 30 3 194 3 eamB Cysteine/O-acetylserine efflux protein Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q31XQ6 5.31e-15 73 30 3 193 3 eamB Cysteine/O-acetylserine efflux protein Shigella boydii serotype 4 (strain Sb227)
Q8XA19 1.12e-14 72 29 3 193 3 eamB Cysteine/O-acetylserine efflux protein Escherichia coli O157:H7
P38102 2.45e-09 58 30 4 170 3 PA4757 Uncharacterized membrane protein PA4757 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A6T515 1.47e-08 55 28 2 135 3 eamB Cysteine/O-acetylserine efflux protein Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A6T7N0 8.03e-08 53 25 3 166 3 leuE Leucine efflux protein Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A4WB82 1.24e-06 50 27 2 116 3 leuE Leucine efflux protein Enterobacter sp. (strain 638)
Q1RAZ2 9.9e-06 48 23 4 168 3 leuE Leucine efflux protein Escherichia coli (strain UTI89 / UPEC)
Q8FGV4 9.9e-06 48 23 4 168 3 leuE Leucine efflux protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TH31 9.9e-06 48 23 4 168 3 leuE Leucine efflux protein Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1ABX2 9.9e-06 48 23 4 168 3 leuE Leucine efflux protein Escherichia coli O1:K1 / APEC
Q321T8 1.11e-05 47 23 4 168 5 leuE Putative leucine efflux protein Shigella boydii serotype 4 (strain Sb227)
Q3Z2D8 1.13e-05 47 23 4 168 3 leuE Leucine efflux protein Shigella sonnei (strain Ss046)
A7ZMR9 1.13e-05 47 23 4 168 3 leuE Leucine efflux protein Escherichia coli O139:H28 (strain E24377A / ETEC)
Q32FT6 1.18e-05 47 23 4 168 3 leuE Leucine efflux protein Shigella dysenteriae serotype 1 (strain Sd197)
A8AHJ0 1.64e-05 47 23 3 166 3 leuE Leucine efflux protein Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q8XDS6 4e-05 46 23 4 168 3 leuE Leucine efflux protein Escherichia coli O157:H7
P76249 6.05e-05 45 23 4 168 1 leuE Leucine efflux protein Escherichia coli (strain K12)
A8A0Z3 6.05e-05 45 23 4 168 3 leuE Leucine efflux protein Escherichia coli O9:H4 (strain HS)
Q7CQP8 0.000319 43 22 3 166 3 leuE Leucine efflux protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XEV9 0.000319 43 22 3 166 3 leuE Leucine efflux protein Salmonella typhi
Q5PHF4 0.000319 43 22 3 166 3 leuE Leucine efflux protein Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57Q25 0.000319 43 22 3 166 3 leuE Leucine efflux protein Salmonella choleraesuis (strain SC-B67)
Q9KVK7 0.000699 42 20 2 196 3 VC_0136 Uncharacterized membrane protein VC_0136 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS14830
Feature type CDS
Gene -
Product LysE family translocator
Location 201067 - 201669 (strand: 1)
Length 603 (nucleotides) / 200 (amino acids)

Contig

Accession term accessions NZ_VXKB01000004 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 258164 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_199
Orthogroup size 9
N. genomes 7

Actions

Genomic region

Domains

PF01810 LysE type translocator

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1280 Amino acid transport and metabolism (E) E Threonine/homoserine/homoserine lactone efflux protein

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K11249 cysteine/O-acetylserine efflux protein - -

Protein Sequence

MTTHLLLSLSVFMFIAAVTPGPNNMLLTASGAQFGIRRTLILMAGIMLGMQTVLYLSAFGVAAILLIYPKLHTAMKIAGSIYLLWLAKKLATAPYEHLDKPQVSKAITWYQGTLLQFINPKAWLMGLGAVGSYSLSGDAYMMSVGVMSIIMITVNLVAGLLWISFGAFIGLFLRSRNAWFTFNIVMGLLTAACVPLIWLE

Flanking regions ( +/- flanking 50bp)

TACTGATAATTTCGTGGAAAGAAAACGTCCACTTTTGCGCAAGGCTGCAAATGACTACTCATCTTTTACTTTCGCTTTCGGTATTCATGTTTATCGCAGCGGTTACGCCCGGTCCTAATAATATGTTACTGACTGCCTCCGGTGCGCAGTTCGGGATCCGTCGGACACTGATCCTGATGGCGGGTATTATGCTTGGAATGCAGACAGTATTATACCTTTCAGCCTTCGGTGTCGCGGCTATTTTACTGATTTATCCGAAATTGCATACTGCTATGAAAATTGCCGGCAGTATTTACCTTTTGTGGCTGGCGAAAAAACTCGCTACCGCGCCGTATGAGCACCTTGATAAACCACAGGTCAGTAAAGCCATCACCTGGTATCAGGGCACGTTATTGCAGTTTATTAATCCCAAAGCCTGGCTGATGGGGCTGGGTGCTGTCGGCAGTTACAGCCTGAGCGGTGACGCGTATATGATGTCCGTTGGGGTGATGAGCATTATAATGATCACCGTGAATCTGGTCGCCGGGTTGCTCTGGATAAGCTTCGGCGCATTTATCGGGCTTTTCCTGCGCAGCCGTAATGCCTGGTTTACGTTCAATATTGTTATGGGATTACTGACGGCTGCATGTGTCCCGCTGATTTGGCTGGAATAATGGGTGCCGGAATCGCTGACCCGGAAACACCTACATAATATAGCCTGTGG