Homologs in group_4148

Help

0 homologs were identified in 0 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product

Distribution of the homologs in the orthogroup group_4148

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_4148

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AEG1 6.66e-150 425 81 0 300 1 dppC Dipeptide transport system permease protein DppC Escherichia coli (strain K12)
P0AEG2 6.66e-150 425 81 0 300 3 dppC Dipeptide transport system permease protein DppC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEG3 6.66e-150 425 81 0 300 3 dppC Dipeptide transport system permease protein DppC Escherichia coli O157:H7
P51000 3.36e-128 369 61 2 300 3 dppC Dipeptide transport system permease protein DppC Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A0A0H2ZFV0 5e-122 354 63 0 284 1 dppC Di/tripeptide transport system permease protein DppC Pseudomonas aeruginosa (strain UCBPP-PA14)
P94312 2.77e-95 286 53 1 285 3 dppC Dipeptide transport system permease protein DppC Alkalihalophilus pseudofirmus (strain ATCC BAA-2126 / JCM 17055 / OF4)
P42063 1.38e-77 241 43 3 291 3 appC Oligopeptide transport system permease protein AppC Bacillus subtilis (strain 168)
P77463 4.18e-70 222 47 4 263 1 ddpC Probable D,D-dipeptide transport system permease protein DdpC Escherichia coli (strain K12)
Q6D3B2 3.79e-68 217 41 1 292 3 gsiD Glutathione transport system permease protein GsiD Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q83S25 5.38e-68 216 40 1 283 3 gsiD Glutathione transport system permease protein GsiD Shigella flexneri
P0C2L2 5.38e-68 216 40 1 283 3 gsiD Glutathione transport system permease protein GsiD Shigella flexneri serotype 5b (strain 8401)
P75799 1.01e-67 216 40 1 283 1 gsiD Glutathione transport system permease protein GsiD Escherichia coli (strain K12)
Q8FJK8 1.11e-67 216 40 1 283 3 gsiD Glutathione transport system permease protein GsiD Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TJL6 1.11e-67 216 40 1 283 3 gsiD Glutathione transport system permease protein GsiD Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q3Z3V1 1.25e-67 216 40 1 283 3 gsiD Glutathione transport system permease protein GsiD Shigella sonnei (strain Ss046)
Q323W2 1.25e-67 216 40 1 283 3 gsiD Glutathione transport system permease protein GsiD Shigella boydii serotype 4 (strain Sb227)
Q8X6V6 1.25e-67 216 40 1 283 3 gsiD Glutathione transport system permease protein GsiD Escherichia coli O157:H7
Q32IB8 4.07e-67 214 40 1 283 3 gsiD Glutathione transport system permease protein GsiD Shigella dysenteriae serotype 1 (strain Sd197)
Q1RE93 9.98e-67 213 39 1 283 3 gsiD Glutathione transport system permease protein GsiD Escherichia coli (strain UTI89 / UPEC)
A1A971 9.98e-67 213 39 1 283 3 gsiD Glutathione transport system permease protein GsiD Escherichia coli O1:K1 / APEC
Q7CQV4 1.21e-62 203 41 1 268 3 gsiD Glutathione transport system permease protein GsiD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XF88 1.21e-62 203 41 1 268 3 gsiD Glutathione transport system permease protein GsiD Salmonella typhi
Q5PGP6 1.21e-62 203 41 1 268 3 gsiD Glutathione transport system permease protein GsiD Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57RA9 1.21e-62 203 41 1 268 3 gsiD Glutathione transport system permease protein GsiD Salmonella choleraesuis (strain SC-B67)
P0A2J5 3.4e-62 201 40 0 288 2 sapC Peptide transport system permease protein SapC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2J6 3.4e-62 201 40 0 288 3 sapC Peptide transport system permease protein SapC Salmonella typhi
P0AGH7 3.01e-61 199 39 0 288 3 sapC Peptide transport system permease protein SapC Shigella flexneri
P0AGH5 3.01e-61 199 39 0 288 1 sapC Putrescine export system permease protein SapC Escherichia coli (strain K12)
P0AGH6 3.01e-61 199 39 0 288 3 sapC Peptide transport system permease protein SapC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8YDG8 1.2e-58 192 39 2 272 3 BMEII0207/BMEII0208 Putative peptide transport system permease protein BMEII0207/BMEII0208 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q2YJK0 1.2e-58 192 39 2 272 3 BAB2_1051 Putative peptide transport system permease protein BAB2_1051 Brucella abortus (strain 2308)
Q8VQK5 1.2e-58 192 39 2 272 3 BruAb2_1032 Putative peptide transport system permease protein BruAb2_1032 Brucella abortus biovar 1 (strain 9-941)
Q8FUW9 4.55e-58 191 41 2 234 3 BRA1093 Putative peptide transport system permease protein BRA1093/BS1330_II1085 Brucella suis biovar 1 (strain 1330)
P26904 8.55e-58 191 38 3 302 2 dppC Dipeptide transport system permease protein DppC Bacillus subtilis (strain 168)
P45287 4.29e-54 181 36 0 275 3 sapC Peptide transport system permease protein SapC Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P24139 7.04e-53 178 38 3 292 1 oppC Oligopeptide transport system permease protein OppC Bacillus subtilis (strain 168)
Q8FWN9 3.09e-50 171 36 2 289 3 BRA0407 Putative peptide permease protein BRA0407/BS1330_II0404 Brucella suis biovar 1 (strain 1330)
A5VU89 1.85e-49 169 35 2 289 3 BOV_A0350 Putative peptide permease protein BOV_A0350 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q8YBN8 2.15e-49 169 35 2 289 3 BMEII0861 Putative peptide permease protein BMEII0861 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q2YK65 2.15e-49 169 35 2 289 3 BAB2_0815 Putative peptide permease protein BAB2_0815 Brucella abortus (strain 2308)
Q577J7 2.15e-49 169 35 2 289 3 BruAb2_0794 Putative peptide permease protein BruAb2_0794 Brucella abortus biovar 1 (strain 9-941)
Q7A0Y0 4.02e-48 165 37 1 228 3 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain MW2)
Q6G9H9 4.02e-48 165 37 1 228 3 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain MSSA476)
Q5HG39 4.02e-48 165 37 1 228 3 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain COL)
Q2FYQ6 4.02e-48 165 37 1 228 1 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH56 4.02e-48 165 37 1 228 3 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain USA300)
Q7A5Q7 6.45e-48 164 37 1 228 3 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain N315)
Q99UA1 6.45e-48 164 37 1 228 3 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q2YXY8 1.15e-47 163 37 1 228 3 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q6GH26 1.47e-47 163 37 1 228 3 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain MRSA252)
Q53192 6.66e-46 159 39 1 219 3 NGR_a01420 Probable peptide ABC transporter permease protein y4tQ Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q2FVE9 1.65e-45 158 33 1 273 1 cntC Metal-staphylopine import system permease protein CntC Staphylococcus aureus (strain NCTC 8325 / PS 47)
A0A0H3JU73 2.43e-45 158 33 1 273 1 cntC Metal-staphylopine import system permease protein CntC Staphylococcus aureus (strain Mu50 / ATCC 700699)
P45053 1.45e-42 151 33 3 300 3 oppC Oligopeptide transport system permease protein OppC Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0AFA9 1.36e-40 145 38 2 222 1 nikC Nickel transport system permease protein NikC Escherichia coli (strain K12)
P0AFB0 1.36e-40 145 38 2 222 3 nikC Nickel transport system permease protein NikC Escherichia coli O157:H7
P08006 1.67e-39 143 33 1 272 1 oppC Oligopeptide transport system permease protein OppC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0AFH6 5.24e-38 139 33 1 272 1 oppC Oligopeptide transport system permease protein OppC Escherichia coli (strain K12)
P0AFH7 5.24e-38 139 33 1 272 3 oppC Oligopeptide transport system permease protein OppC Escherichia coli O157:H7
P66965 5.75e-37 136 33 4 257 3 BQ2027_MB1313C Putative peptide transport permease protein Mb1313c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WFZ9 5.75e-37 136 33 4 257 1 Rv1282c Putative peptide transport permease protein Rv1282c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WFZ8 5.75e-37 136 33 4 257 3 MT1319 Putative peptide transport permease protein MT1319 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A4P0 7.83e-33 125 32 10 297 3 oppC Oligopeptide transport system permease protein OppC Lactococcus lactis subsp. cremoris (strain SK11)
P0A4N9 1.34e-32 125 32 10 297 1 oppC Oligopeptide transport system permease protein OppC Lactococcus lactis subsp. lactis (strain IL1403)
Q7D203 9.44e-30 119 32 2 218 3 yejE Peptidoglycan transport system permease protein YejE Agrobacterium fabrum (strain C58 / ATCC 33970)
A2RI76 9.65e-30 118 26 4 330 1 dppC Dipeptide transport system permease protein DppC Lactococcus lactis subsp. cremoris (strain MG1363)
P33915 4.67e-22 97 29 2 218 1 yejE Inner membrane ABC transporter permease protein YejE Escherichia coli (strain K12)
P0A4N0 3.28e-16 80 22 4 293 3 amiD Oligopeptide transport system permease protein AmiD Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A4M9 3.28e-16 80 22 4 293 3 amiD Oligopeptide transport system permease protein AmiD Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
P47324 2.12e-11 67 28 8 243 3 oppC Oligopeptide transport system permease protein OppC Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
P75553 3.56e-10 63 28 8 235 3 oppC Oligopeptide transport system permease protein OppC Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS14675
Feature type CDS
Gene dppC
Product dipeptide ABC transporter permease DppC
Location 171025 - 171927 (strand: 1)
Length 903 (nucleotides) / 300 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000004
Length 258164 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_4148
Orthogroup size 1
N. genomes 1

Actions

Genomic region

Domains

PF00528 Binding-protein-dependent transport system inner membrane component
PF12911 N-terminal TM domain of oligopeptide transport permease C

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1173 Amino acid transport and metabolism (E)
Inorganic ion transport and metabolism (P)
EP ABC-type dipeptide/oligopeptide/nickel transport system, permease component

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K12370 dipeptide transport system permease protein ABC transporters -

Protein Sequence

MSDSTNNVVTRAPEPLSPLREFWVYFSRNKGALIGLIYILLMLLIAIFAPLLAPHLPDEQFRTHLLQPPVWQEGGSWEFMLGTDDIGRDILSRLMFGARLSLLVGCLVVALSLLMGVVVGLVAGYFGGWIDALIMRIVDIMLALPSLLLALVLVAIFGPSIVNASLALTFVALPHYIRLTRAAVLTEVSRDYVTASGVAGAGAARQMFVNILPNCLAPLIVQASLGFSNAILDMAALGFLGMGAQPPTPEWGTMLSDVLQFTQSAWWVVTFPGLAILLTVLAFNLMGDGLRDALDPKLKQ

Flanking regions ( +/- flanking 50bp)

ACGGTGTCATTAATCCGCGGATCCGCCACAAAAAATAAGAGGAGCGCACGATGTCTGATTCAACGAACAATGTTGTTACCCGCGCGCCTGAGCCTCTCTCTCCGCTGCGCGAATTCTGGGTTTATTTCAGTCGCAACAAAGGTGCATTAATCGGATTGATTTATATCCTGCTGATGCTGCTGATTGCGATTTTCGCCCCGTTGCTTGCCCCGCATCTGCCGGATGAGCAGTTCCGCACACATTTATTGCAGCCGCCTGTCTGGCAGGAAGGGGGTTCGTGGGAATTTATGCTCGGCACTGATGATATCGGACGGGATATATTGTCCCGCCTGATGTTTGGTGCCCGCCTCTCGTTACTGGTGGGCTGCCTGGTGGTTGCGCTCTCATTACTGATGGGTGTGGTGGTGGGATTGGTTGCCGGCTATTTCGGCGGCTGGATTGATGCCCTGATCATGCGCATCGTCGATATCATGCTGGCACTGCCGAGCCTGCTGCTGGCGCTGGTGCTGGTGGCTATCTTCGGACCATCGATTGTGAATGCCTCGCTGGCACTGACCTTTGTCGCACTGCCGCACTATATCCGCCTGACGCGGGCAGCGGTACTCACTGAAGTCAGCCGTGATTATGTCACGGCTTCCGGCGTGGCGGGCGCAGGTGCTGCCCGCCAGATGTTTGTGAATATTTTGCCGAACTGTCTCGCGCCGCTGATTGTGCAGGCGTCTCTGGGCTTTTCCAACGCCATTTTGGATATGGCGGCGTTAGGTTTCTTAGGCATGGGCGCACAGCCGCCGACACCGGAGTGGGGAACGATGCTCTCCGATGTTTTACAGTTTACGCAAAGTGCCTGGTGGGTGGTGACCTTCCCGGGACTGGCGATTTTACTGACGGTACTGGCGTTTAACCTGATGGGCGACGGATTGCGTGATGCCCTTGATCCTAAGCTGAAGCAGTAGAGGTGCAGACATGGCGTTATTAACAGTTGATAAATTATCTGTTCACTTCG