Homologs in group_1775

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_12105 FBDBKF_12105 92.3 Morganella morganii S1 glnL nitrogen regulation protein NR(II)
EHELCC_14200 EHELCC_14200 92.3 Morganella morganii S2 glnL nitrogen regulation protein NR(II)
NLDBIP_15295 NLDBIP_15295 92.3 Morganella morganii S4 glnL nitrogen regulation protein NR(II)
LHKJJB_15315 LHKJJB_15315 92.3 Morganella morganii S3 glnL nitrogen regulation protein NR(II)
HKOGLL_14435 HKOGLL_14435 92.3 Morganella morganii S5 glnL nitrogen regulation protein NR(II)
PMI_RS14250 PMI_RS14250 73.3 Proteus mirabilis HI4320 glnL nitrogen regulation protein NR(II)

Distribution of the homologs in the orthogroup group_1775

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1775

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P06218 0.0 514 72 0 343 3 ntrB Sensory histidine kinase/phosphatase NtrB Klebsiella oxytoca
P0A2D9 0.0 511 72 0 344 3 glnL Sensory histidine kinase/phosphatase NtrB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2E0 0.0 511 72 0 344 3 glnL Sensory histidine kinase/phosphatase NtrB Salmonella typhi
P0AFB7 7.32e-180 504 70 0 349 3 glnL Sensory histidine kinase/phosphatase NtrB Shigella flexneri
P0AFB5 7.32e-180 504 70 0 349 1 glnL Sensory histidine kinase/phosphatase NtrB Escherichia coli (strain K12)
P0AFB6 7.32e-180 504 70 0 349 3 glnL Sensory histidine kinase/phosphatase NtrB Escherichia coli O157:H7
P28788 1.42e-175 494 72 0 348 3 ntrB Sensory histidine kinase/phosphatase NtrB Proteus hauseri
P19906 6.54e-131 380 56 2 340 3 ntrB Sensory histidine kinase/phosphatase NtrB Vibrio alginolyticus
P09431 6.74e-48 168 34 9 361 3 ntrB Sensory histidine kinase/phosphatase NtrB Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
P45670 1.67e-42 155 31 6 346 3 None Sensory histidine kinase/phosphatase NtrB Azospirillum brasilense
P10578 1.02e-39 147 33 8 356 3 ntrB Sensory histidine kinase/phosphatase NtrB Bradyrhizobium sp. (strain RP501 Parasponia)
P41503 1.09e-36 139 36 5 238 3 ntrB Sensory histidine kinase/phosphatase NtrB Rhizobium leguminosarum bv. phaseoli
Q52977 8.6e-36 137 30 8 352 3 ntrB Sensory histidine kinase/phosphatase NtrB Rhizobium meliloti (strain 1021)
Q06067 8.27e-28 117 26 11 361 1 atoS Signal transduction histidine-protein kinase AtoS Escherichia coli (strain K12)
Q9APE0 7.59e-24 105 30 7 240 3 zraS Sensor histidine kinase ZraS Klebsiella oxytoca
P14377 3.31e-23 103 29 6 242 1 zraS Sensor histidine kinase ZraS Escherichia coli (strain K12)
Q8X614 2.16e-22 100 29 6 242 3 zraS Sensor histidine kinase ZraS Escherichia coli O157:H7
Q8Z332 3.08e-20 94 28 6 241 3 zraS Sensor histidine kinase ZraS Salmonella typhi
P37461 1.05e-19 93 28 6 241 2 zraS Sensor histidine kinase ZraS Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P10799 2e-19 93 29 11 280 1 virA Wide host range VirA protein Agrobacterium tumefaciens (strain 15955)
P07168 2.38e-19 92 29 11 280 3 virA Wide host range VirA protein Rhizobium radiobacter
O31661 7.74e-18 88 28 8 244 1 kinE Sporulation kinase E Bacillus subtilis (strain 168)
Q08430 1.31e-17 86 25 8 265 3 kinB Sporulation kinase B Bacillus subtilis (strain 168)
Q02482 9.02e-17 85 26 11 319 3 Sfri_3689 Putative sensor protein Sfri_3689 Shewanella frigidimarina (strain NCIMB 400)
O31671 5.83e-16 82 28 6 225 1 kinD Sporulation kinase D Bacillus subtilis (strain 168)
Q48IV1 1.69e-15 80 28 15 348 3 PSPPH_2483 Blue-light-activated protein Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
O34206 1.8e-15 80 26 12 358 1 kinB Alginate biosynthesis sensor protein KinB Pseudomonas aeruginosa
P10047 2.31e-15 80 29 8 251 3 dctB C4-dicarboxylate transport sensor protein DctB Rhizobium leguminosarum
P16497 2.7e-15 80 24 8 240 1 kinA Sporulation kinase A Bacillus subtilis (strain 168)
P54302 3.05e-15 80 25 14 306 1 luxQ Autoinducer 2 sensor kinase/phosphatase LuxQ Vibrio harveyi
Q04850 3.13e-15 80 29 7 226 3 ntrY Nitrogen regulation protein NtrY Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
P39764 3.71e-15 79 25 9 252 1 kinC Sporulation kinase C Bacillus subtilis (strain 168)
P13633 4.58e-15 79 29 9 257 1 dctB C4-dicarboxylate transport sensor protein DctB Rhizobium meliloti (strain 1021)
Q7U871 8.63e-15 78 29 10 278 3 sasA Adaptive-response sensory kinase SasA Parasynechococcus marenigrum (strain WH8102)
O69729 2.03e-14 77 27 7 247 1 tcrY Probable sensor histidine kinase TcrY Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
A7HD43 2.08e-14 77 25 4 216 1 gchK Globin-coupled histidine kinase Anaeromyxobacter sp. (strain Fw109-5)
Q03069 4.58e-14 75 24 4 235 3 degM Sensor protein DegM Bacillus sp. (strain B21-2)
P58356 5.11e-14 76 31 15 254 3 torS Sensor protein TorS Escherichia coli O157:H7
P39453 8.35e-14 76 30 14 252 1 torS Sensor protein TorS Escherichia coli (strain K12)
Q8D5Z6 1.05e-13 75 26 14 289 3 luxQ Autoinducer 2 sensor kinase/phosphatase LuxQ Vibrio vulnificus (strain CMCP6)
Q7MD16 1.21e-13 75 26 13 287 3 luxQ Autoinducer 2 sensor kinase/phosphatase LuxQ Vibrio vulnificus (strain YJ016)
Q7V6P7 1.25e-13 74 28 7 228 3 sasA Adaptive-response sensory kinase SasA Prochlorococcus marinus (strain MIT 9313)
P35164 1.49e-13 75 26 10 234 1 resE Sensor histidine kinase ResE Bacillus subtilis (strain 168)
A2C884 3.9e-13 73 28 7 228 3 sasA Adaptive-response sensory kinase SasA Prochlorococcus marinus (strain MIT 9303)
A5A2P0 4.38e-13 73 26 8 239 3 walK Sensor protein kinase WalK (Fragment) Mammaliicoccus sciuri
Q881J7 5.79e-13 73 26 14 346 1 PSPTO_2896 Blue-light-activated protein Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q7BWI3 6.66e-13 72 27 8 229 3 sasA Adaptive-response sensory kinase SasA Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
P45608 1.12e-12 72 27 15 352 3 phoR Phosphate regulon sensor protein PhoR Klebsiella pneumoniae
P18540 1.13e-12 72 26 11 272 3 virA Wide host range VirA protein Agrobacterium fabrum (strain C58 / ATCC 33970)
Q3AYV8 1.21e-12 71 28 10 278 3 sasA Adaptive-response sensory kinase SasA Synechococcus sp. (strain CC9902)
Q87GU5 1.7e-12 72 26 15 300 3 luxQ Autoinducer 2 sensor kinase/phosphatase LuxQ Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q4ZSY3 2.2e-12 71 29 10 268 3 Psyr_2700 Blue-light-activated protein Pseudomonas syringae pv. syringae (strain B728a)
P37739 3.28e-12 71 27 6 229 3 dctS C4-dicarboxylate transport sensor protein DctS Rhodobacter capsulatus
P08400 3.31e-12 70 31 14 240 1 phoR Phosphate regulon sensor protein PhoR Escherichia coli (strain K12)
P26489 7.76e-12 69 28 10 269 3 fixL Sensor protein FixL Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q0IBF4 8.92e-12 69 28 11 279 3 sasA Adaptive-response sensory kinase SasA Synechococcus sp. (strain CC9311)
P10955 9.07e-12 69 23 11 363 1 fixL Sensor protein FixL Rhizobium meliloti (strain 1021)
Q8DPL8 9.35e-12 69 27 10 234 1 walK Sensor histidine protein kinase/phosphatase WalK Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
A0A0H2ZNH9 9.35e-12 69 27 10 234 1 walK Sensor histidine protein kinase/phosphatase WalK Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
A6QD58 1.17e-11 69 24 13 327 3 walK Sensor protein kinase WalK Staphylococcus aureus (strain Newman)
P23545 1.22e-11 69 28 13 252 1 phoR Alkaline phosphatase synthesis sensor protein PhoR Bacillus subtilis (strain 168)
P94414 1.59e-11 68 26 10 264 3 yclK Sensor histidine kinase YclK Bacillus subtilis (strain 168)
B1WYT4 1.63e-11 68 27 11 270 3 sasA Adaptive-response sensory kinase SasA Crocosphaera subtropica (strain ATCC 51142 / BH68)
Q8KIY1 2.16e-11 68 26 8 274 1 tmoS Sensor histidine kinase TmoS Pseudomonas mendocina
Q8KIY1 1.47e-09 63 25 19 383 1 tmoS Sensor histidine kinase TmoS Pseudomonas mendocina
Q9RDT3 2.42e-11 68 26 9 238 1 walK Sensor protein kinase WalK (Fragment) Staphylococcus aureus
P45609 2.64e-11 67 30 13 240 3 phoR Phosphate regulon sensor protein PhoR Shigella dysenteriae
Q7A215 3.12e-11 68 26 8 229 3 walK Sensor protein kinase WalK Staphylococcus aureus (strain MW2)
A8YYU2 3.12e-11 68 26 8 229 3 walK Sensor protein kinase WalK Staphylococcus aureus (strain USA300 / TCH1516)
Q6GD71 3.12e-11 68 26 8 229 3 walK Sensor protein kinase WalK Staphylococcus aureus (strain MSSA476)
Q7A8E0 3.12e-11 68 26 8 229 1 walK Sensor protein kinase WalK Staphylococcus aureus (strain N315)
Q7A305 3.12e-11 68 26 8 229 3 walK Sensor protein kinase WalK Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HJX6 3.12e-11 68 26 8 229 3 walK Sensor protein kinase WalK Staphylococcus aureus (strain COL)
Q2YUQ2 3.12e-11 68 26 8 229 3 walK Sensor protein kinase WalK Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5INR0 3.12e-11 68 26 8 229 3 walK Sensor protein kinase WalK Staphylococcus aureus (strain JH9)
Q2G2U4 3.12e-11 68 26 8 229 1 walK Sensor protein kinase WalK Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FKN7 3.12e-11 68 26 8 229 3 walK Sensor protein kinase WalK Staphylococcus aureus (strain USA300)
A6TXG9 3.12e-11 68 26 8 229 3 walK Sensor protein kinase WalK Staphylococcus aureus (strain JH1)
A7WWQ7 3.12e-11 68 26 8 229 3 walK Sensor protein kinase WalK Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q6GKS6 3.32e-11 68 26 8 229 3 walK Sensor protein kinase WalK Staphylococcus aureus (strain MRSA252)
E0X9C7 3.33e-11 68 27 5 222 1 todS Sensor histidine kinase TodS Pseudomonas putida (strain DOT-T1E)
E0X9C7 4.27e-06 52 32 8 120 1 todS Sensor histidine kinase TodS Pseudomonas putida (strain DOT-T1E)
A5W4E3 3.36e-11 68 27 5 222 1 todS Sensor histidine kinase TodS Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
A5W4E3 4.5e-06 52 32 8 120 1 todS Sensor histidine kinase TodS Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
P0DOA0 4.64e-11 67 30 10 244 1 cckA Sensor kinase CckA Brucella abortus (strain 2308)
Q4A159 4.99e-11 67 25 8 229 3 walK Sensor protein kinase WalK Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
P37894 6.12e-11 67 27 12 254 1 pleC Non-motile and phage-resistance protein Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q4LAJ8 7.21e-11 67 25 9 230 3 walK Sensor protein kinase WalK Staphylococcus haemolyticus (strain JCSC1435)
B0JK50 7.27e-11 66 27 11 254 3 sasA Adaptive-response sensory kinase SasA Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
Q54U87 8.55e-11 67 23 6 242 1 dhkA Hybrid signal transduction histidine kinase A Dictyostelium discoideum
P33639 1.63e-10 65 27 7 214 1 pilS Sensor protein kinase PilS Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8CU87 1.71e-10 65 25 10 233 1 walK Sensor protein kinase WalK Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HK19 1.71e-10 65 25 10 233 1 walK Sensor protein kinase WalK Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q1RJB3 2.18e-10 65 24 9 225 3 RBE_0470 Putative sensor histidine kinase NtrY-like Rickettsia bellii (strain RML369-C)
Q07737 2.63e-10 65 26 5 213 3 chvG Sensor protein ChvG Agrobacterium fabrum (strain C58 / ATCC 33970)
Q9RQQ9 4.59e-10 64 26 8 231 1 divL Sensor protein DivL Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q9KLK7 4.6e-10 64 25 16 370 1 luxQ Autoinducer 2 sensor kinase/phosphatase LuxQ Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9ZCU7 6.02e-10 63 24 8 225 3 RP614 Putative sensor histidine kinase NtrY-like Rickettsia prowazekii (strain Madrid E)
P72292 7.25e-10 63 28 5 224 3 chvG Sensor protein ChvG Rhizobium meliloti (strain 1021)
Q7A0W5 8.59e-10 63 27 12 236 3 arlS Signal transduction histidine-protein kinase ArlS Staphylococcus aureus (strain MW2)
Q6G9E7 8.59e-10 63 27 12 236 3 arlS Signal transduction histidine-protein kinase ArlS Staphylococcus aureus (strain MSSA476)
Q7A5N3 8.59e-10 63 27 12 236 1 arlS Signal transduction histidine-protein kinase ArlS Staphylococcus aureus (strain N315)
Q7A2R7 8.59e-10 63 27 12 236 3 arlS Signal transduction histidine-protein kinase ArlS Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HG05 8.59e-10 63 27 12 236 3 arlS Signal transduction histidine-protein kinase ArlS Staphylococcus aureus (strain COL)
Q9KJN3 8.59e-10 63 27 12 236 1 arlS Signal transduction histidine-protein kinase ArlS Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH24 8.59e-10 63 27 12 236 3 arlS Signal transduction histidine-protein kinase ArlS Staphylococcus aureus (strain USA300)
Q2YY04 8.75e-10 63 27 12 236 3 arlS Signal transduction histidine-protein kinase ArlS Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q6GGZ4 9.07e-10 63 27 12 236 3 arlS Signal transduction histidine-protein kinase ArlS Staphylococcus aureus (strain MRSA252)
Q54SP4 9.24e-10 63 24 10 230 2 dhkD Hybrid signal transduction histidine kinase D Dictyostelium discoideum
Q55630 9.5e-10 63 26 9 253 1 sasA Adaptive-response sensory kinase SasA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q92H24 9.87e-10 63 24 8 224 3 RC0948 Putative sensor histidine kinase NtrY-like Rickettsia conorii (strain ATCC VR-613 / Malish 7)
B7K3M6 1.02e-09 62 24 11 285 3 sasA Adaptive-response sensory kinase SasA Rippkaea orientalis (strain PCC 8801 / RF-1)
P15939 1.22e-09 63 25 10 251 4 nodV Nodulation protein V Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
P0C0F7 1.28e-09 63 27 11 274 1 rpfC Sensory/regulatory protein RpfC Xanthomonas campestris pv. campestris (strain 8004)
A0A4P7TSF2 1.31e-09 62 26 7 224 1 envZ Sensor histidine kinase EnvZ Shigella flexneri serotype 5a (strain M90T)
P0AEJ5 1.31e-09 62 26 7 224 1 envZ Sensor histidine kinase EnvZ Shigella flexneri
P0AEJ4 1.31e-09 62 26 7 224 1 envZ Sensor histidine kinase EnvZ Escherichia coli (strain K12)
P0C0F6 1.32e-09 63 27 11 274 1 rpfC Sensory/regulatory protein RpfC Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q9HUI3 1.41e-09 63 26 9 238 3 aruS Sensor histidine kinase AruS Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P20169 1.89e-09 62 24 15 382 3 dspA Drug sensory protein A Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q4UMD4 1.99e-09 62 23 8 224 3 RF_0427 Putative sensor histidine kinase NtrY-like Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q06240 1.99e-09 62 24 15 343 1 vanS Sensor protein VanS Enterococcus faecium
A6X5X4 2.23e-09 62 21 16 401 3 pdhS Cell-division control histidine kinase PdhS Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
B7KFU0 2.8e-09 61 27 12 254 3 sasA Adaptive-response sensory kinase SasA Gloeothece citriformis (strain PCC 7424)
P48027 2.85e-09 62 26 7 234 3 gacS Sensor protein GacS Pseudomonas syringae pv. syringae
P45675 3.01e-09 62 28 10 232 3 None Nitrogen regulation protein NtrY homolog Azospirillum brasilense
Q6GIT7 3.82e-09 60 25 9 247 3 saeS Histidine protein kinase SaeS Staphylococcus aureus (strain MRSA252)
Q06904 3.92e-09 61 32 5 133 1 sasA Adaptive-response sensory kinase SasA Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q7A1J2 4.07e-09 60 25 9 247 3 saeS Histidine protein kinase SaeS Staphylococcus aureus (strain MW2)
Q6GBC5 4.07e-09 60 25 9 247 3 saeS Histidine protein kinase SaeS Staphylococcus aureus (strain MSSA476)
Q7A6V4 4.07e-09 60 25 9 247 1 saeS Histidine protein kinase SaeS Staphylococcus aureus (strain N315)
Q99VR8 4.07e-09 60 25 9 247 3 saeS Histidine protein kinase SaeS Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q2YSM6 4.07e-09 60 25 9 247 3 saeS Histidine protein kinase SaeS Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q68WC5 4.82e-09 61 23 9 234 3 RT0603 Putative sensor histidine kinase NtrY-like Rickettsia typhi (strain ATCC VR-144 / Wilmington)
P21865 6.44e-09 61 26 10 250 1 kdpD Sensor protein KdpD Escherichia coli (strain K12)
P23222 6.88e-09 60 23 13 375 1 fixL Sensor protein FixL Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
P59342 8.62e-09 60 24 7 238 3 barA Signal transduction histidine-protein kinase BarA Shigella flexneri
P0AEC5 9.02e-09 60 24 7 238 1 barA Signal transduction histidine-protein kinase BarA Escherichia coli (strain K12)
P0AEC6 9.02e-09 60 24 7 238 1 barA Signal transduction histidine-protein kinase BarA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEC7 9.02e-09 60 24 7 238 3 barA Signal transduction histidine-protein kinase BarA Escherichia coli O157:H7
Q45614 9.09e-09 60 26 12 250 1 walK Sensor histidine kinase WalK Bacillus subtilis (strain 168)
P07167 1.04e-08 60 23 9 287 3 virA Limited host range VirA protein Rhizobium radiobacter
A2BRQ6 1.2e-08 59 26 6 230 3 sasA Adaptive-response sensory kinase SasA Prochlorococcus marinus (strain AS9601)
Q840P7 1.23e-08 59 25 8 247 1 saeS Histidine protein kinase SaeS Staphylococcus aureus (strain Newman)
Q5HHW5 1.27e-08 59 25 8 247 1 saeS Histidine protein kinase SaeS Staphylococcus aureus (strain COL)
Q2G2U1 1.27e-08 59 25 8 247 1 saeS Histidine protein kinase SaeS Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FIT5 1.27e-08 59 25 8 247 3 saeS Histidine protein kinase SaeS Staphylococcus aureus (strain USA300)
P08982 1.36e-08 59 25 7 220 3 envZ Sensor histidine kinase EnvZ Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A0A0H3NIL4 1.36e-08 59 25 7 220 3 envZ Sensor histidine kinase EnvZ Salmonella typhimurium (strain SL1344)
Q8CTI3 1.42e-08 59 25 8 233 3 saeS Histidine protein kinase SaeS Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HR29 1.42e-08 59 25 8 233 3 saeS Histidine protein kinase SaeS Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q7V113 1.85e-08 58 28 8 232 3 sasA Adaptive-response sensory-kinase SasA Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
P52101 1.88e-08 59 28 11 230 1 glrK Sensor histidine kinase GlrK Escherichia coli (strain K12)
Q8DMT2 2.1e-08 58 28 15 271 1 sasA Adaptive-response sensory kinase SasA Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q9F8D7 2.16e-08 59 27 8 234 3 gacS Sensor histidine kinase GacS Pseudomonas protegens (strain DSM 19095 / LMG 27888 / CFBP 6595 / CHA0)
Q8XA47 2.42e-08 58 28 11 230 1 qseE Sensor histidine kinase QseE Escherichia coli O157:H7
P51392 3e-08 58 23 14 360 3 ycf26 Uncharacterized sensor-like histidine kinase ycf26 Porphyra purpurea
A3PDI2 3.49e-08 58 26 6 230 3 sasA Adaptive-response sensory kinase SasA Prochlorococcus marinus (strain MIT 9301)
A0A0H3GPN8 4.11e-08 58 25 9 234 2 cpxA Sensor histidine kinase CpxA Klebsiella pneumoniae subsp. pneumoniae (strain HS11286)
P41406 4.39e-08 58 25 7 224 3 envZ Sensor histidine kinase EnvZ Salmonella typhi
P39928 5.03e-08 58 39 2 74 1 SLN1 Osmosensing histidine protein kinase SLN1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q2JKD9 5.76e-08 57 26 14 334 3 sasA Adaptive-response sensory kinase SasA Synechococcus sp. (strain JA-2-3B'a(2-13))
Q7A5H7 5.99e-08 57 24 11 233 1 srrB Sensor protein SrrB Staphylococcus aureus (strain N315)
Q99TZ9 5.99e-08 57 24 11 233 3 srrB Sensor protein SrrB Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q31AE8 7.5e-08 57 26 6 230 3 sasA Adaptive-response sensory kinase SasA Prochlorococcus marinus (strain MIT 9312)
Q5HPC4 7.72e-08 57 27 12 247 3 arlS Signal transduction histidine-protein kinase ArlS Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P0AE82 8.46e-08 57 26 9 234 1 cpxA Sensor histidine kinase CpxA Escherichia coli (strain K12)
P0AE83 8.46e-08 57 26 9 234 3 cpxA Sensor protein CpxA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AE84 8.46e-08 57 26 9 234 3 cpxA Sensor protein CpxA Escherichia coli O157:H7
Q2JWK9 8.55e-08 57 32 6 135 3 sasA Adaptive-response sensory kinase SasA Synechococcus sp. (strain JA-3-3Ab)
Q9L523 8.79e-08 57 23 11 233 1 srrB Sensor protein SrrB Staphylococcus aureus
B0CI82 8.87e-08 57 22 16 382 3 pdhS Cell-division control histidine kinase PdhS Brucella suis (strain ATCC 23445 / NCTC 10510)
Q8NWF3 9.19e-08 57 23 11 233 3 srrB Sensor protein SrrB Staphylococcus aureus (strain MW2)
Q6G973 9.19e-08 57 23 11 233 3 srrB Sensor protein SrrB Staphylococcus aureus (strain MSSA476)
Q5HFT1 9.19e-08 57 23 11 233 2 srrB Sensor protein SrrB Staphylococcus aureus (strain COL)
Q2FY80 9.19e-08 57 23 11 233 3 srrB Sensor protein SrrB Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q8FZ86 9.44e-08 57 22 16 382 3 pdhS Cell-division control histidine kinase PdhS Brucella suis biovar 1 (strain 1330)
Q6GGK7 1.08e-07 57 23 11 233 3 srrB Sensor protein SrrB Staphylococcus aureus (strain MRSA252)
A9M715 1.18e-07 57 22 16 382 3 pdhS Cell-division control histidine kinase PdhS Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q8CSL7 1.37e-07 56 26 11 246 3 arlS Signal transduction histidine-protein kinase ArlS Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
P94608 1.79e-07 56 23 11 240 3 kdpD Sensor protein KdpD Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q57BR6 2.17e-07 56 21 15 382 1 pdhS Cell-division control histidine kinase PdhS Brucella abortus biovar 1 (strain 9-941)
Q2YRB4 2.17e-07 56 21 15 382 3 pdhS Cell-division control histidine kinase PdhS Brucella abortus (strain 2308)
B2S758 2.17e-07 56 21 15 382 3 pdhS Cell-division control histidine kinase PdhS Brucella abortus (strain S19)
Q8YIM6 2.21e-07 56 21 15 382 3 pdhS Cell-division control histidine kinase PdhS Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
P49333 2.44e-07 56 25 9 267 1 ETR1 Ethylene receptor 1 Arabidopsis thaliana
Q9XH58 2.62e-07 55 23 8 272 2 ETR1 Ethylene receptor 1 Pelargonium hortorum
P08401 2.67e-07 55 26 7 208 1 creC Sensor protein CreC Escherichia coli (strain K12)
A8G5E7 2.92e-07 55 25 6 230 3 sasA Adaptive-response sensory kinase SasA Prochlorococcus marinus (strain MIT 9215)
O14002 2.93e-07 56 27 11 237 3 mak2 Peroxide stress-activated histidine kinase mak2 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P0AEC4 2.94e-07 55 26 11 249 3 arcB Aerobic respiration control sensor protein ArcB Shigella flexneri
P0AEC3 2.94e-07 55 26 11 249 1 arcB Aerobic respiration control sensor protein ArcB Escherichia coli (strain K12)
P58363 2.99e-07 55 26 11 250 3 arcB Aerobic respiration control sensor protein ArcB Escherichia coli O157:H7
Q9KHI5 3.04e-07 55 25 11 235 1 cikA Circadian input-output histidine kinase CikA Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q9P4U6 3.17e-07 55 39 2 76 1 tcsB Two-component system protein B Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q8YR50 3.4e-07 55 32 7 131 3 sasA Adaptive-response sensory kinase SasA Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q9HWA7 3.85e-07 55 24 13 352 1 pprA Two-component sensor PprA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9P896 5.13e-07 55 22 7 240 3 tcsA Two-component system protein A Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q3M8A7 5.56e-07 54 32 7 131 3 sasA Adaptive-response sensory kinase SasA Trichormus variabilis (strain ATCC 29413 / PCC 7937)
P74111 5.9e-07 55 27 13 249 1 cikA Circadian input-output histidine kinase CikA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q8DKG0 7.62e-07 54 24 8 235 1 cikA Circadian input-output histidine kinase CikA Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
T2KMF4 8.67e-07 54 25 12 258 3 BN863_21930 Histidine kinase P4 Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1)
A0QTK3 9.44e-07 54 24 11 256 3 mtrB Sensor histidine kinase MtrB Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q869S5 2.5e-06 53 24 8 237 1 dokA Hybrid signal transduction protein dokA Dictyostelium discoideum
Q8DMC5 2.66e-06 52 29 11 232 1 hik2 Sensor histidine kinase Hik2 Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
P9WGK7 2.72e-06 52 28 10 243 1 prrB Sensor-type histidine kinase PrrB Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGK6 2.72e-06 52 28 10 243 3 prrB Sensor-type histidine kinase PrrB Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A5Z9 2.72e-06 52 28 10 243 3 prrB Sensor-type histidine kinase PrrB Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
A1A699 2.79e-06 52 45 1 60 1 HK6 Probable histidine kinase 6 Oryza sativa subsp. japonica
A5VRX4 2.86e-06 52 21 15 382 3 pdhS Cell-division control histidine kinase PdhS Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q8ZPP6 3.11e-06 52 27 7 222 1 ttrS Tetrathionate sensor histidine kinase TtrS Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
O49230 3.14e-06 52 24 9 268 2 ETR1 Ethylene receptor 1 Brassica oleracea
Q95PI2 3.52e-06 52 24 6 237 1 dhkC Hybrid signal transduction histidine kinase C Dictyostelium discoideum
Q54YZ9 3.96e-06 52 23 6 232 3 dhkJ Hybrid signal transduction histidine kinase J Dictyostelium discoideum
Q3S4A7 4.1e-06 52 24 8 247 1 AHK5 Histidine kinase 5 Arabidopsis thaliana
Q4L6C5 4.9e-06 51 27 9 218 3 arlS Signal transduction histidine-protein kinase ArlS Staphylococcus haemolyticus (strain JCSC1435)
O87939 5.02e-06 52 22 4 161 3 tdiS Sensor protein TdiS Thauera aromatica
O32193 5.11e-06 51 22 7 221 1 cssS Sensor histidine kinase CssS Bacillus subtilis (strain 168)
Q86CZ2 5.5e-06 52 27 14 272 1 dhkK Hybrid signal transduction histidine kinase K Dictyostelium discoideum
A0QR01 5.58e-06 51 23 10 255 1 senX3 Sensor-like histidine kinase SenX3 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q5A872 5.7e-06 52 38 2 75 1 SLN1 Histidine protein kinase SLN1 Candida albicans (strain SC5314 / ATCC MYA-2876)
Q54YH4 9.24e-06 51 23 8 239 1 dhkB Hybrid signal transduction histidine kinase B Dictyostelium discoideum
Q54RP6 9.76e-06 51 21 11 349 3 dhkL Hybrid signal transduction histidine kinase L Dictyostelium discoideum
P37433 9.93e-06 50 33 3 98 1 pgtB Phosphoglycerate transport system sensor protein PgtB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q5A599 1.01e-05 51 23 7 240 1 NIK1 Histidine protein kinase NIK1 Candida albicans (strain SC5314 / ATCC MYA-2876)
O34989 1.35e-05 50 24 9 225 3 yvrG Sensor histidine kinase YvrG Bacillus subtilis (strain 168)
Q9ZWL6 1.53e-05 50 23 7 269 2 ETR1 Ethylene receptor Passiflora edulis
Q9CCJ1 1.59e-05 50 26 11 245 3 mtrB Sensor histidine kinase MtrB Mycobacterium leprae (strain TN)
Q9HV31 1.6e-05 50 28 6 212 2 pmrB Sensor protein kinase PmrB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9C5U1 1.69e-05 50 20 8 267 1 AHK3 Histidine kinase 3 Arabidopsis thaliana
Q49ZT9 1.72e-05 50 25 8 224 3 hssS Heme sensor protein HssS Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
P0AEC8 2.66e-05 49 28 11 222 1 dcuS Sensor histidine kinase DcuS Escherichia coli (strain K12)
P0AEC9 2.66e-05 49 28 11 222 3 dcuS Sensor histidine kinase DcuS Escherichia coli O157:H7
O34638 2.68e-05 49 26 11 219 3 ykoH Sensor histidine kinase YkoH Bacillus subtilis (strain 168)
P59340 2.69e-05 49 28 11 222 3 dcuS Sensor histidine kinase DcuS Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P59341 2.71e-05 49 28 11 222 3 dcuS Sensor histidine kinase DcuS Shigella flexneri
Q49XM6 3.73e-05 48 25 10 232 3 arlS Signal transduction histidine-protein kinase ArlS Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q55168 3.93e-05 49 23 11 253 1 cph1 Phytochrome-like protein Cph1 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q83RR1 4.4e-05 48 26 9 215 3 phoQ Virulence sensor protein PhoQ Shigella flexneri
Q56128 4.43e-05 49 25 11 251 3 rcsC Sensor histidine kinase RcsC Salmonella typhi
Q08408 4.47e-05 48 25 10 229 3 rprX Sensor protein RprX Bacteroides fragilis (strain YCH46)
Q55932 4.47e-05 48 25 7 226 1 rppB Sensor histidine kinase RppB Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P23837 4.77e-05 48 26 9 215 1 phoQ Sensor protein PhoQ Escherichia coli (strain K12)
Q8FIB8 4.9e-05 48 26 9 215 3 phoQ Sensor protein PhoQ Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P9WGK5 5.39e-05 48 24 10 245 1 senX3 Sensor-like histidine kinase SenX3 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGK4 5.39e-05 48 24 10 245 2 senX3 Sensor-like histidine kinase SenX3 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A601 5.39e-05 48 24 10 245 1 senX3 Sensor-like histidine kinase SenX3 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q93CB7 5.68e-05 48 24 10 252 3 mtrB Sensor histidine kinase MtrB Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Q8X739 5.95e-05 48 26 9 214 3 phoQ Sensor protein PhoQ Escherichia coli O157:H7
A1TEL6 6.6e-05 48 27 14 239 3 mprB Signal transduction histidine-protein kinase/phosphatase MprB Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q9C5U2 6.66e-05 48 20 7 273 1 AHK2 Histidine kinase 2 Arabidopsis thaliana
P40758 6.78e-05 48 28 4 114 1 glnK Sensor histidine kinase GlnK Bacillus subtilis (strain 168)
Q5AHA0 9.15e-05 48 25 11 247 2 CHK1 Histidine protein kinase 1 Candida albicans (strain SC5314 / ATCC MYA-2876)
O48929 0.000105 47 22 8 274 2 ETR1 Ethylene receptor Nicotiana tabacum
P18392 0.000147 47 27 10 239 1 rstB Sensor protein RstB Escherichia coli (strain K12)
P33113 0.000149 47 24 7 212 3 spaK Sensor histidine kinase SpaK Bacillus subtilis
P9WGK8 0.000167 47 24 8 242 3 mtrB Sensor histidine kinase MtrB Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P59963 0.000167 47 24 8 242 3 mtrB Sensor histidine kinase MtrB Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P26762 0.00017 47 26 7 222 3 bvgS Virulence sensor protein BvgS Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
P9WGK9 0.000171 47 24 8 242 1 mtrB Sensor histidine kinase MtrB Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q03228 0.000196 47 25 11 264 1 divJ Histidine protein kinase DivJ Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q04943 0.000222 46 24 10 250 3 afsQ2 Signal transduction histidine-protein kinase AfsQ2 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
I1WSZ3 0.000235 46 26 10 230 3 irlS Sensor protein IrlS Burkholderia pseudomallei (strain 1026b)
P54883 0.000281 46 25 9 237 3 senX3 Sensor-like histidine kinase SenX3 Mycobacterium leprae (strain TN)
P42499 0.000353 46 20 7 263 3 PHYB Phytochrome B Glycine max
A1A698 0.000366 46 38 1 60 2 HK4 Probable histidine kinase 4 Oryza sativa subsp. japonica
P33529 0.000401 46 22 9 268 2 PHY Phytochrome Mougeotia scalaris
Q9SSY6 0.000401 45 23 7 234 2 ETR1 Ethylene receptor 1 Cucumis sativus
P0DMK6 0.000413 45 27 11 231 3 irlS Sensor protein IrlS Burkholderia pseudomallei (strain K96243)
Q9ZHD4 0.000423 45 26 13 233 3 silS Probable sensor kinase SilS Salmonella typhimurium
A0QBR0 0.000468 45 27 13 247 3 mprB Signal transduction histidine-protein kinase/phosphatase MprB Mycobacterium avium (strain 104)
P93527 0.000493 45 21 7 262 1 PHYB Phytochrome B Sorghum bicolor
P40330 0.000506 45 25 7 222 3 bvgS Virulence sensor protein BvgS Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q8DXQ8 0.000543 45 21 7 230 3 dltS Sensor protein DltS Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q9Z5G7 0.000582 45 28 14 248 3 mprB Signal transduction histidine-protein kinase/phosphatase MprB Mycobacterium leprae (strain TN)
P96601 0.000621 45 26 11 267 3 dctS Probable C4-dicarboxylate sensor kinase Bacillus subtilis (strain 168)
Q9P7Q7 0.000768 45 23 9 250 3 mak1 Peroxide stress-activated histidine kinase mak1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P9WGL2 0.00078 45 26 8 237 3 kdpD Sensor protein KdpD Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P9WGL3 0.000808 45 26 8 237 1 kdpD Sensor protein KdpD Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P30844 0.000889 44 26 9 211 1 basS Sensor protein BasS Escherichia coli (strain K12)
P45336 0.001 44 27 12 213 1 qseC Sensor protein QseC Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9HZ47 0.001 44 35 3 84 1 gtrS Sensor histidine kinase GtrS Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS14535
Feature type CDS
Gene glnL
Product nitrogen regulation protein NR(II)
Location 137131 - 138180 (strand: -1)
Length 1050 (nucleotides) / 349 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000004
Length 258164 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1775
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00512 His Kinase A (phospho-acceptor) domain
PF02518 Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
PF08448 PAS fold

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3852 Signal transduction mechanisms (T) T Signal transduction histidine kinase NtrB, nitrogen specific

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07708 two-component system, NtrC family, nitrogen regulation sensor histidine kinase GlnL [EC:2.7.13.3] Two-component system -

Protein Sequence

MDRDNKPQAEQLLNSLINCVLLLDTDLIIRYANQAAMQLFAQSARKLSGTPLPILFSYLSLDSATLQATLAEGLSFTDNDVTLVVNNQMHALSLSAQPVSGDFILLELTPLDSHRRISQEQLQQAQQTAARDLVRGLAHEIKNPLGGLRGAAQLLSRALPDPALQEYTQVIIEQADRLRALVDRLLGPQHPGQKSLQSIHHVAERVFQLINLEKPENITLIKDYDPSLPELSHYPDQIEQVVLNIMRNALEAVKTPGGTITLRTRTAFQVTLHGERYRLAARIDIEDNGPGIPAHIRDTLFYPMVSGREGGSGLGLSIARSLTDQHHGKIEFTSWPGHTLFSLYLPIRQ

Flanking regions ( +/- flanking 50bp)

GAGTAAATACGCTACAATGCACCAAATTGGTGCAATCGGGGGTAGTTACAATGGACAGGGATAATAAACCGCAGGCAGAGCAACTGCTTAACTCACTGATCAATTGTGTACTGTTACTGGATACGGATTTAATTATCCGCTATGCCAACCAGGCCGCAATGCAGTTGTTTGCCCAGAGCGCCCGTAAGCTCTCCGGCACCCCACTCCCCATCTTATTCAGTTATCTTTCGCTCGACAGCGCCACATTGCAGGCGACACTGGCGGAAGGACTCAGTTTTACAGATAACGATGTAACCCTGGTGGTCAACAACCAGATGCACGCCCTCTCTCTGAGCGCCCAGCCGGTTTCCGGTGATTTTATTCTGCTGGAGCTTACGCCGCTCGACAGCCACCGCCGTATCAGTCAGGAACAATTGCAACAGGCGCAGCAGACAGCAGCAAGAGACCTGGTGCGCGGGCTGGCACATGAGATTAAAAATCCGCTCGGCGGACTGCGCGGAGCGGCACAGCTTCTGTCCCGCGCACTGCCGGACCCGGCGCTGCAGGAATATACACAGGTGATTATCGAGCAGGCAGACCGCCTGCGGGCACTGGTTGATCGCCTGCTGGGTCCTCAGCATCCGGGACAAAAAAGTCTGCAAAGTATTCACCATGTGGCAGAACGGGTATTTCAGCTGATCAATCTGGAAAAACCGGAAAATATCACACTGATTAAGGATTATGACCCCAGTTTGCCGGAGTTATCGCATTATCCCGACCAGATCGAGCAGGTTGTCCTCAATATCATGCGTAATGCCCTGGAAGCCGTGAAAACCCCGGGCGGAACCATCACATTGCGCACCCGTACTGCATTTCAGGTAACGCTGCACGGTGAACGCTACCGGCTGGCAGCACGTATTGATATTGAAGATAACGGACCGGGCATTCCGGCACACATCAGAGATACTCTGTTTTACCCGATGGTCAGCGGGCGTGAAGGCGGCTCCGGTCTGGGGCTGTCCATTGCCCGGAGTCTGACCGATCAACACCACGGCAAGATAGAATTTACCAGTTGGCCGGGTCACACCTTATTTTCACTTTATCTGCCAATCCGTCAGTAACTGCATTTATCAGGGGAGGTTCACATGCAACCGGGAAAAATTTGGGTCGT