Homologs in group_1672

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_10735 FBDBKF_10735 91.3 Morganella morganii S1 greB transcription elongation factor GreB
EHELCC_15070 EHELCC_15070 91.3 Morganella morganii S2 greB transcription elongation factor GreB
NLDBIP_14900 NLDBIP_14900 91.3 Morganella morganii S4 greB transcription elongation factor GreB
LHKJJB_14445 LHKJJB_14445 91.3 Morganella morganii S3 greB transcription elongation factor GreB
HKOGLL_13065 HKOGLL_13065 91.3 Morganella morganii S5 greB transcription elongation factor GreB
PMI_RS14285 PMI_RS14285 82.4 Proteus mirabilis HI4320 greB transcription elongation factor GreB

Distribution of the homologs in the orthogroup group_1672

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1672

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q8ZJH2 8.8e-90 261 78 0 161 3 greB Transcription elongation factor GreB Yersinia pestis
P43882 1.98e-77 230 71 0 157 3 greB Transcription elongation factor GreB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q7VM42 2.32e-77 230 70 0 156 3 greB Transcription elongation factor GreB Haemophilus ducreyi (strain 35000HP / ATCC 700724)
P57802 8.81e-77 228 71 0 157 3 greB Transcription elongation factor GreB Pasteurella multocida (strain Pm70)
Q9KNL7 6.2e-60 186 58 1 156 3 greB Transcription elongation factor GreB Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8Z217 4.26e-59 183 59 0 154 3 greB Transcription elongation factor GreB Salmonella typhi
Q8ZLJ2 1.13e-58 182 59 0 154 3 greB Transcription elongation factor GreB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q7MPX6 1.45e-57 180 57 1 155 3 greB Transcription elongation factor GreB Vibrio vulnificus (strain YJ016)
Q8DDU7 1.45e-57 180 57 1 155 3 greB Transcription elongation factor GreB Vibrio vulnificus (strain CMCP6)
P30128 2.28e-57 179 58 0 154 1 greB Transcription elongation factor GreB Escherichia coli (strain K12)
P64273 4.49e-57 178 57 0 154 3 greB Transcription elongation factor GreB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P64274 4.49e-57 178 57 0 154 3 greB Transcription elongation factor GreB Escherichia coli O157:H7
Q9HZY5 1.76e-56 177 59 0 157 3 greB Transcription elongation factor GreB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q88KH5 2.75e-56 176 56 0 153 3 greB Transcription elongation factor GreB Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q87TB8 7.87e-55 173 53 1 156 3 greB Transcription elongation factor GreB Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q883T5 2.48e-53 169 53 0 154 3 greB Transcription elongation factor GreB Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q8P7P8 7.83e-44 145 51 1 154 3 greB Transcription elongation factor GreB Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q8PJ11 1.28e-43 144 51 1 154 3 greB Transcription elongation factor GreB Xanthomonas axonopodis pv. citri (strain 306)
Q9K0C5 4.67e-42 140 49 1 153 3 greB Transcription elongation factor GreB Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q9JVD0 3.99e-41 138 49 1 153 3 greB Transcription elongation factor GreB Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A1AZ46 1.05e-33 119 43 2 151 3 greA Transcription elongation factor GreA Paracoccus denitrificans (strain Pd 1222)
Q31H97 3.9e-33 117 42 3 154 3 greA Transcription elongation factor GreA Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
A4WVE8 1.61e-32 116 44 2 151 3 greA Transcription elongation factor GreA Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
A1WXX6 2.19e-32 115 42 3 159 3 greA Transcription elongation factor GreA Halorhodospira halophila (strain DSM 244 / SL1)
A1V9Q2 4.02e-32 115 43 2 151 3 greA Transcription elongation factor GreA Nitratidesulfovibrio vulgaris (strain DP4)
Q725M4 4.02e-32 115 43 2 151 3 greA Transcription elongation factor GreA Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
B5YJG9 4.67e-31 112 40 1 152 3 greA Transcription elongation factor GreA Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
Q2G656 5.68e-31 112 42 1 146 3 greA Transcription elongation factor GreA Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
B8DJL8 7.21e-31 112 40 2 152 3 greA Transcription elongation factor GreA Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
Q3J5L0 8.57e-31 111 42 2 151 3 greA Transcription elongation factor GreA Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A1ST36 1.14e-30 111 40 3 153 3 greA Transcription elongation factor GreA Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
B9KLF5 1.26e-30 111 42 2 151 3 greA Transcription elongation factor GreA Cereibacter sphaeroides (strain KD131 / KCTC 12085)
A3PGS3 1.26e-30 111 42 2 151 3 greA Transcription elongation factor GreA Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
A5WDP3 1.44e-30 111 41 3 154 3 greA Transcription elongation factor GreA Psychrobacter sp. (strain PRwf-1)
A0LK20 1.71e-30 111 41 1 150 3 greA Transcription elongation factor GreA Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
Q0A765 1.73e-30 111 40 4 159 3 greA Transcription elongation factor GreA Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
B8IZM4 1.83e-30 111 39 2 152 3 greA Transcription elongation factor GreA Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
Q3A452 5.65e-30 109 41 1 157 3 greA Transcription elongation factor GreA Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
P64281 1.08e-29 108 39 2 152 3 greA Transcription elongation factor GreA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P64282 1.08e-29 108 39 2 152 3 greA Transcription elongation factor GreA Salmonella typhi
Q5LXA4 1.19e-29 108 42 3 152 3 greA Transcription elongation factor GreA Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q9JTT4 1.58e-29 108 42 3 158 3 greA Transcription elongation factor GreA Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
P0A6W8 2.03e-29 108 38 2 152 3 greA Transcription elongation factor GreA Shigella flexneri
P0A6W5 2.03e-29 108 38 2 152 1 greA Transcription elongation factor GreA Escherichia coli (strain K12)
P0A6W6 2.03e-29 108 38 2 152 3 greA Transcription elongation factor GreA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A6W7 2.03e-29 108 38 2 152 3 greA Transcription elongation factor GreA Escherichia coli O157:H7
A4IZ52 2.36e-29 108 41 2 153 3 greA Transcription elongation factor GreA Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NFC6 2.36e-29 108 41 2 153 3 greA Transcription elongation factor GreA Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q0BKZ4 2.36e-29 108 41 2 153 3 greA Transcription elongation factor GreA Francisella tularensis subsp. holarctica (strain OSU18)
A0Q5P2 2.36e-29 108 41 2 153 3 greA Transcription elongation factor GreA Francisella tularensis subsp. novicida (strain U112)
B2SDF5 2.36e-29 108 41 2 153 3 greA Transcription elongation factor GreA Francisella tularensis subsp. mediasiatica (strain FSC147)
Q2A2C7 2.36e-29 108 41 2 153 3 greA Transcription elongation factor GreA Francisella tularensis subsp. holarctica (strain LVS)
A7NDI1 2.36e-29 108 41 2 153 3 greA Transcription elongation factor GreA Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Q14GS9 2.36e-29 108 41 2 153 3 greA Transcription elongation factor GreA Francisella tularensis subsp. tularensis (strain FSC 198)
A1WH11 3.93e-29 107 40 2 153 3 greA Transcription elongation factor GreA Verminephrobacter eiseniae (strain EF01-2)
Q8XZ82 3.97e-29 107 42 2 152 3 greA Transcription elongation factor GreA Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
A1AS07 4.19e-29 107 40 1 158 3 greA Transcription elongation factor GreA Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
A6Q4L2 5.65e-29 107 39 2 160 3 greA Transcription elongation factor GreA Nitratiruptor sp. (strain SB155-2)
B2IHJ7 7.16e-29 107 40 1 152 3 greA Transcription elongation factor GreA Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
Q4FTJ2 7.6e-29 107 40 2 152 3 greA Transcription elongation factor GreA Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
B0TYL2 8.02e-29 107 41 2 153 3 greA Transcription elongation factor GreA Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
P43881 8.29e-29 106 39 3 153 3 greA Transcription elongation factor GreA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
B9KDP9 9.39e-29 106 35 1 154 3 greA Transcription elongation factor GreA Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
Q9HV46 1.06e-28 106 38 2 152 3 greA Transcription elongation factor GreA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A9R594 1.07e-28 106 38 2 152 3 greA Transcription elongation factor GreA Yersinia pestis bv. Antiqua (strain Angola)
Q8ZBB3 1.07e-28 106 38 2 152 3 greA Transcription elongation factor GreA Yersinia pestis
Q1QCJ2 1.11e-28 106 39 2 152 3 greA Transcription elongation factor GreA Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
B0U8M0 1.13e-28 106 42 1 151 3 greA Transcription elongation factor GreA Methylobacterium sp. (strain 4-46)
Q9JYU3 1.2e-28 106 41 3 158 3 greA Transcription elongation factor GreA Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
B3E3H5 1.22e-28 106 40 1 158 3 greA Transcription elongation factor GreA Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
Q0C4H1 1.33e-28 106 42 1 152 3 greA Transcription elongation factor GreA Hyphomonas neptunium (strain ATCC 15444)
P57801 1.39e-28 106 38 3 156 3 greA Transcription elongation factor GreA Pasteurella multocida (strain Pm70)
A5V3E1 1.44e-28 106 42 1 146 3 greA Transcription elongation factor GreA Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
Q607B0 1.57e-28 106 41 4 160 3 greA Transcription elongation factor GreA Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
B9L822 2.55e-28 105 39 1 155 3 greA Transcription elongation factor GreA Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH)
B8D7R9 3.83e-28 105 39 3 156 3 greA Transcription elongation factor GreA Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57464 3.83e-28 105 39 3 156 3 greA Transcription elongation factor GreA Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D9G7 3.83e-28 105 39 3 156 3 greA Transcription elongation factor GreA Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
Q7VL00 4.78e-28 104 41 3 134 3 greA Transcription elongation factor GreA Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q7M9N2 5.39e-28 104 38 1 155 3 greA Transcription elongation factor GreA Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
C4K7K9 5.51e-28 104 39 2 152 3 greA Transcription elongation factor GreA Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
B0VSL8 8.67e-28 104 41 2 141 3 greA Transcription elongation factor GreA Acinetobacter baumannii (strain SDF)
A1UTG0 9.72e-28 103 40 1 151 3 greA Transcription elongation factor GreA Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
Q1GUG9 2.32e-27 103 39 1 146 3 greA Transcription elongation factor GreA Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
P64275 2.42e-27 103 34 1 155 3 greA Transcription elongation factor GreA Helicobacter pylori (strain ATCC 700392 / 26695)
P64276 2.42e-27 103 34 1 155 3 greA Transcription elongation factor GreA Helicobacter pylori (strain J99 / ATCC 700824)
A9IRC3 3.33e-27 102 39 1 151 3 greA Transcription elongation factor GreA Bartonella tribocorum (strain CIP 105476 / IBS 506)
A5FWZ7 3.33e-27 102 38 2 152 3 greA Transcription elongation factor GreA Acidiphilium cryptum (strain JF-5)
Q88DU7 4.39e-27 102 38 3 153 3 greA Transcription elongation factor GreA Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q1CT06 4.72e-27 102 34 1 155 3 greA Transcription elongation factor GreA Helicobacter pylori (strain HPAG1)
B5Z7M6 4.72e-27 102 34 1 155 3 greA Transcription elongation factor GreA Helicobacter pylori (strain G27)
B6JM90 4.72e-27 102 34 1 155 3 greA Transcription elongation factor GreA Helicobacter pylori (strain P12)
Q7VJT9 5.77e-27 102 34 1 155 3 greA Transcription elongation factor GreA Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q6FZ57 6.11e-27 102 39 1 151 3 greA Transcription elongation factor GreA Bartonella quintana (strain Toulouse)
Q68VQ2 6.9e-27 102 39 1 154 3 greA Transcription elongation factor GreA Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q1LSK1 7.96e-27 101 38 2 152 3 greA Transcription elongation factor GreA Baumannia cicadellinicola subsp. Homalodisca coagulata
B8IBN8 9.46e-27 101 40 1 151 3 greA Transcription elongation factor GreA Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
Q17WJ3 9.85e-27 101 34 1 155 3 greA Transcription elongation factor GreA Helicobacter acinonychis (strain Sheeba)
B2USW4 1.05e-26 101 33 1 155 3 greA Transcription elongation factor GreA Helicobacter pylori (strain Shi470)
B8GNX7 1.25e-26 101 40 4 159 3 greA Transcription elongation factor GreA Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q1RKI0 1.31e-26 101 37 1 155 3 greA Transcription elongation factor GreA Rickettsia bellii (strain RML369-C)
A8GUN3 1.31e-26 101 37 1 155 3 greA Transcription elongation factor GreA Rickettsia bellii (strain OSU 85-389)
Q28V47 1.38e-26 101 38 2 151 3 greA Transcription elongation factor GreA Jannaschia sp. (strain CCS1)
Q4UJS8 1.86e-26 100 38 1 154 3 greA Transcription elongation factor GreA Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
A6U8X4 2.25e-26 100 38 1 151 3 greA Transcription elongation factor GreA Sinorhizobium medicae (strain WSM419)
P56894 2.25e-26 100 38 1 151 3 greA Transcription elongation factor GreA Rhizobium meliloti (strain 1021)
C6BRV2 2.72e-26 100 36 2 152 3 greA Transcription elongation factor GreA Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
A1AXD2 4.68e-26 99 37 3 153 3 greA Transcription elongation factor GreA Ruthia magnifica subsp. Calyptogena magnifica
Q92FZ5 4.72e-26 99 38 1 154 3 greA Transcription elongation factor GreA Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q3J822 4.73e-26 99 39 2 153 3 greA Transcription elongation factor GreA Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
P27640 5.43e-26 99 38 1 154 3 greA Transcription elongation factor GreA Rickettsia prowazekii (strain Madrid E)
A8ESG0 6.15e-26 99 36 1 155 3 greA Transcription elongation factor GreA Aliarcobacter butzleri (strain RM4018)
A8F083 6.38e-26 99 37 1 154 3 greA Transcription elongation factor GreA Rickettsia canadensis (strain McKiel)
Q6G2M7 6.58e-26 99 37 1 151 3 greA Transcription elongation factor GreA Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
P59489 8.7e-26 99 35 3 154 3 greA Transcription elongation factor GreA Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q8PLD9 1.07e-25 99 39 3 154 3 greA Transcription elongation factor GreA Xanthomonas axonopodis pv. citri (strain 306)
Q8UDE5 1.18e-25 98 38 2 152 3 greA Transcription elongation factor GreA Agrobacterium fabrum (strain C58 / ATCC 33970)
A1VN58 1.75e-25 98 39 2 152 3 greA Transcription elongation factor GreA Polaromonas naphthalenivorans (strain CJ2)
Q4FPG2 2.05e-25 98 38 2 152 3 greA Transcription elongation factor GreA Pelagibacter ubique (strain HTCC1062)
A8HR94 2.07e-25 98 38 3 152 3 greA Transcription elongation factor GreA Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q11GG5 2.11e-25 98 39 1 151 3 greA Transcription elongation factor GreA Chelativorans sp. (strain BNC1)
B9J753 2.47e-25 97 39 1 151 3 greA Transcription elongation factor GreA Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
A5IAV2 2.57e-25 97 38 3 153 3 greA Transcription elongation factor GreA Legionella pneumophila (strain Corby)
Q5WTH5 3.3e-25 97 38 3 153 3 greA Transcription elongation factor GreA Legionella pneumophila (strain Lens)
Q5ZS95 3.3e-25 97 38 3 153 3 greA Transcription elongation factor GreA Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q5X1R6 3.3e-25 97 38 3 153 3 greA Transcription elongation factor GreA Legionella pneumophila (strain Paris)
B9JYZ7 4.92e-25 97 36 2 152 3 greA Transcription elongation factor GreA Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
Q8D2W9 6.52e-25 97 37 3 153 3 greA Transcription elongation factor GreA Wigglesworthia glossinidia brevipalpis
Q493U4 6.59e-25 97 37 4 158 3 greA Transcription elongation factor GreA Blochmanniella pennsylvanica (strain BPEN)
B4UCU9 6.74e-25 97 37 1 151 3 greA Transcription elongation factor GreA Anaeromyxobacter sp. (strain K)
Q98I49 6.77e-25 96 37 1 151 3 greA Transcription elongation factor GreA Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q0AMQ6 7.23e-25 96 39 1 151 3 greA Transcription elongation factor GreA Maricaulis maris (strain MCS10)
O50237 9.82e-25 96 38 1 146 3 greA Transcription elongation factor GreA Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
A7H585 1.22e-24 96 35 1 154 3 greA Transcription elongation factor GreA Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
Q5HWI0 1.39e-24 96 34 1 154 3 greA Transcription elongation factor GreA Campylobacter jejuni (strain RM1221)
Q9PIK9 1.39e-24 96 34 1 154 3 greA Transcription elongation factor GreA Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A8FK75 1.39e-24 96 34 1 154 3 greA Transcription elongation factor GreA Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
B0SZ84 1.83e-24 95 38 1 151 3 greA Transcription elongation factor GreA Caulobacter sp. (strain K31)
Q87WP5 2.16e-24 95 36 2 152 3 greA Transcription elongation factor GreA Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
B3QPT8 2.21e-24 95 36 1 150 3 greA Transcription elongation factor GreA Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
A0LC15 2.22e-24 95 38 1 151 3 greA Transcription elongation factor GreA Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
Q2K600 2.28e-24 95 38 1 151 3 greA Transcription elongation factor GreA Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q9L4D3 2.3e-24 95 38 2 152 3 greA Transcription elongation factor GreA Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B3PUK3 2.48e-24 95 38 1 151 3 greA Transcription elongation factor GreA Rhizobium etli (strain CIAT 652)
P64272 2.81e-24 95 36 1 151 3 greA Transcription elongation factor GreA Brucella suis biovar 1 (strain 1330)
B0CHU1 2.81e-24 95 36 1 151 3 greA Transcription elongation factor GreA Brucella suis (strain ATCC 23445 / NCTC 10510)
P64271 2.81e-24 95 36 1 151 3 greA Transcription elongation factor GreA Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0REE0 2.81e-24 95 36 1 151 3 greA Transcription elongation factor GreA Brucella melitensis biotype 2 (strain ATCC 23457)
A9M6H1 2.81e-24 95 36 1 151 3 greA Transcription elongation factor GreA Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q57C09 2.81e-24 95 36 1 151 3 greA Transcription elongation factor GreA Brucella abortus biovar 1 (strain 9-941)
Q2YRN8 2.81e-24 95 36 1 151 3 greA Transcription elongation factor GreA Brucella abortus (strain 2308)
B2S6W5 2.81e-24 95 36 1 151 3 greA Transcription elongation factor GreA Brucella abortus (strain S19)
A4SFN0 3.3e-24 95 38 1 150 3 greA Transcription elongation factor GreA Chlorobium phaeovibrioides (strain DSM 265 / 1930)
Q8K9G6 3.96e-24 94 36 3 156 3 greA Transcription elongation factor GreA Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
A1VY10 4.08e-24 94 34 1 154 3 greA Transcription elongation factor GreA Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
B3CTQ6 5.24e-24 94 39 1 151 3 greA Transcription elongation factor GreA Orientia tsutsugamushi (strain Ikeda)
Q3ATA7 6.39e-24 94 36 1 154 3 greA Transcription elongation factor GreA Chlorobium chlorochromatii (strain CaD3)
A5CE64 6.79e-24 94 39 1 151 3 greA Transcription elongation factor GreA Orientia tsutsugamushi (strain Boryong)
Q9PEC0 6.98e-24 94 37 3 154 3 greA Transcription elongation factor GreA Xylella fastidiosa (strain 9a5c)
A6WZH2 7.83e-24 94 37 2 152 3 greA Transcription elongation factor GreA Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
B5ZXG2 8.21e-24 94 38 1 151 3 greA Transcription elongation factor GreA Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q87EB7 8.48e-24 94 37 3 153 3 greA Transcription elongation factor GreA Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I844 8.48e-24 94 37 3 153 3 greA Transcription elongation factor GreA Xylella fastidiosa (strain M23)
O68546 1.05e-23 93 38 1 151 3 greA Transcription elongation factor GreA Rhizobium leguminosarum bv. viciae
Q1MDR7 1.05e-23 93 38 1 151 3 greA Transcription elongation factor GreA Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
B9LBX1 1.13e-23 93 37 1 154 3 greA Transcription elongation factor GreA Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl)
A9WK05 1.13e-23 93 37 1 154 3 greA Transcription elongation factor GreA Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
B4RH54 1.23e-23 93 37 1 151 3 greA Transcription elongation factor GreA Phenylobacterium zucineum (strain HLK1)
Q2RQB1 1.42e-23 93 40 1 147 3 greA Transcription elongation factor GreA Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
B3QJZ1 1.58e-23 93 36 1 152 3 greA Transcription elongation factor GreA Rhodopseudomonas palustris (strain TIE-1)
Q6N2H8 1.58e-23 93 36 1 152 3 greA Transcription elongation factor GreA Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
B0U568 2.19e-23 92 37 3 153 3 greA Transcription elongation factor GreA Xylella fastidiosa (strain M12)
B8H1V7 2.51e-23 92 37 1 151 3 greA Transcription elongation factor GreA Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A4I3 2.51e-23 92 37 1 151 3 greA Transcription elongation factor GreA Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
A5CVW9 3.6e-23 92 35 3 153 3 greA Transcription elongation factor GreA Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
B8G358 3.94e-23 92 36 1 154 3 greA Transcription elongation factor GreA Chloroflexus aggregans (strain MD-66 / DSM 9485)
Q87LZ2 4.25e-23 92 38 3 152 3 greA Transcription elongation factor GreA Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A7I2X0 4.38e-23 92 30 1 159 3 greA Transcription elongation factor GreA Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
Q8KCH5 5.2e-23 92 35 1 150 3 greA Transcription elongation factor GreA Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q8DBW9 1.04e-22 91 40 2 132 3 greA Transcription elongation factor GreA Vibrio vulnificus (strain CMCP6)
B4SBF9 1.09e-22 91 36 1 150 3 greA Transcription elongation factor GreA Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
C4XLU8 1.71e-22 90 37 1 131 3 greA Transcription elongation factor GreA Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
Q2LR03 4.64e-22 89 34 1 153 3 greA Transcription elongation factor GreA Syntrophus aciditrophicus (strain SB)
B3EPH3 6.74e-22 89 34 1 157 3 greA Transcription elongation factor GreA Chlorobium phaeobacteroides (strain BS1)
A5ER96 6.92e-22 89 35 1 152 3 greA Transcription elongation factor GreA Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
A6Q9U9 1.09e-21 88 35 2 151 3 greA Transcription elongation factor GreA Sulfurovum sp. (strain NBC37-1)
B3EE12 2.63e-21 87 34 1 150 3 greA Transcription elongation factor GreA Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
Q97EB6 2.82e-21 87 37 2 155 3 greA Transcription elongation factor GreA Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
B4S9B2 3.38e-21 87 33 1 151 3 greA Transcription elongation factor GreA Prosthecochloris aestuarii (strain DSM 271 / SK 413)
Q9KU89 3.45e-21 87 39 3 133 3 greA Transcription elongation factor GreA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q2GD99 3.79e-21 87 34 1 152 3 greA Transcription elongation factor GreA Neorickettsia sennetsu (strain ATCC VR-367 / Miyayama)
Q6MTU9 4.06e-21 87 34 2 142 3 greA Transcription elongation factor GreA Mycoplasma mycoides subsp. mycoides SC (strain CCUG 32753 / NCTC 10114 / PG1)
A1BHJ3 4.17e-21 87 35 1 150 3 greA Transcription elongation factor GreA Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
Q5KWV4 4.63e-21 87 34 1 150 3 greA Transcription elongation factor GreA Geobacillus kaustophilus (strain HTA426)
Q65GT4 4.68e-21 87 36 1 149 3 greA Transcription elongation factor GreA Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
A4IR71 4.73e-21 87 35 1 150 3 greA Transcription elongation factor GreA Geobacillus thermodenitrificans (strain NG80-2)
Q6F215 5.23e-21 86 34 1 141 3 greA Transcription elongation factor GreA Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1)
Q20ZR6 5.86e-21 86 35 1 152 3 greA Transcription elongation factor GreA Rhodopseudomonas palustris (strain BisB18)
B9L0L0 6.35e-21 86 37 3 147 3 greA Transcription elongation factor GreA Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2)
Q3SPT8 6.6e-21 86 35 1 152 3 greA Transcription elongation factor GreA Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q1QJF3 9.3e-21 86 35 1 152 3 greA Transcription elongation factor GreA Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q07JJ7 1.05e-20 86 34 1 152 3 greA Transcription elongation factor GreA Rhodopseudomonas palustris (strain BisA53)
Q89DR1 2.44e-20 85 35 1 152 3 greA Transcription elongation factor GreA Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q88ZS9 2.76e-20 84 34 3 152 3 greA1 Transcription elongation factor GreA 1 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
B0K5B9 2.77e-20 85 34 2 157 3 greA Transcription elongation factor GreA Thermoanaerobacter sp. (strain X514)
B0KCE3 2.77e-20 85 34 2 157 3 greA Transcription elongation factor GreA Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
Q88WQ9 2.82e-20 85 34 1 149 3 greA2 Transcription elongation factor GreA 2 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q2SSM5 2.92e-20 84 34 2 142 3 greA Transcription elongation factor GreA Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
A0PXN3 3.56e-20 84 36 1 155 3 greA Transcription elongation factor GreA Clostridium novyi (strain NT)
Q8R7N0 4.84e-20 84 34 2 157 3 greA Transcription elongation factor GreA Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q7NBS1 8.49e-20 83 36 2 144 3 greA Transcription elongation factor GreA Mycoplasmoides gallisepticum (strain R(low / passage 15 / clone 2))
Q03YY4 1.29e-19 83 36 1 140 3 greA Transcription elongation factor GreA Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q8EPT6 2.75e-19 82 34 2 155 3 greA Transcription elongation factor GreA Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
B0S216 3.45e-19 82 33 1 151 3 greA Transcription elongation factor GreA Finegoldia magna (strain ATCC 29328 / DSM 20472 / WAL 2508)
P80240 1.24e-18 80 34 3 152 1 greA Transcription elongation factor GreA Bacillus subtilis (strain 168)
B1MX52 1.89e-18 80 36 1 141 3 greA Transcription elongation factor GreA Leuconostoc citreum (strain KM20)
A5I7P5 2e-18 80 35 2 156 3 greA Transcription elongation factor GreA Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FZA6 2e-18 80 35 2 156 3 greA Transcription elongation factor GreA Clostridium botulinum (strain ATCC 19397 / Type A)
A3DJG6 2.1e-18 80 34 2 155 3 greA Transcription elongation factor GreA Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
B1KTC2 2.27e-18 80 35 2 156 3 greA Transcription elongation factor GreA Clostridium botulinum (strain Loch Maree / Type A3)
A7GJB4 2.27e-18 80 35 2 156 3 greA Transcription elongation factor GreA Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
B1IGJ3 2.27e-18 80 35 2 156 3 greA Transcription elongation factor GreA Clostridium botulinum (strain Okra / Type B1)
C3KVU0 2.27e-18 80 35 2 156 3 greA Transcription elongation factor GreA Clostridium botulinum (strain 657 / Type Ba4)
Q5WHM1 2.74e-18 79 35 1 154 3 greA Transcription elongation factor GreA Shouchella clausii (strain KSM-K16)
Q181F4 2.84e-18 79 34 2 155 3 greA Transcription elongation factor GreA Clostridioides difficile (strain 630)
A5N4L0 3.29e-18 79 34 2 155 3 greA Transcription elongation factor GreA Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9DY72 3.29e-18 79 34 2 155 3 greA Transcription elongation factor GreA Clostridium kluyveri (strain NBRC 12016)
B3QV56 4.78e-18 79 31 2 157 3 greA Transcription elongation factor GreA Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
A7NFC5 7.23e-18 78 33 1 150 3 greA Transcription elongation factor GreA Roseiflexus castenholzii (strain DSM 13941 / HLO8)
C1FNC6 8.9e-18 78 34 2 156 3 greA Transcription elongation factor GreA Clostridium botulinum (strain Kyoto / Type A2)
Q6AL57 1.02e-17 78 34 2 147 3 greA Transcription elongation factor GreA Desulfotalea psychrophila (strain LSv54 / DSM 12343)
A0M5U7 1.1e-17 78 30 1 155 3 greA Transcription elongation factor GreA Christiangramia forsetii (strain DSM 17595 / CGMCC 1.15422 / KT0803)
A5ILE7 1.11e-17 78 32 2 149 3 greA Transcription elongation factor GreA Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
A0AIU5 1.15e-17 78 34 1 143 3 greA Transcription elongation factor GreA Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q5ZZL8 1.24e-17 78 38 2 136 3 greA Transcription elongation factor GreA Mesomycoplasma hyopneumoniae (strain 232)
Q4A759 1.52e-17 77 38 2 136 3 greA Transcription elongation factor GreA Mesomycoplasma hyopneumoniae (strain 7448)
Q9X232 1.52e-17 77 32 2 149 3 greA Transcription elongation factor GreA Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q4A921 1.71e-17 77 38 2 136 3 greA Transcription elongation factor GreA Mesomycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110)
A9KIP3 1.82e-17 77 37 2 156 3 greA Transcription elongation factor GreA Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
A7Z726 2.01e-17 77 34 2 149 3 greA Transcription elongation factor GreA Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
B9K7Y7 3.11e-17 77 32 2 149 3 greA Transcription elongation factor GreA Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E)
B1LAX5 3.43e-17 77 31 2 149 3 greA Transcription elongation factor GreA Thermotoga sp. (strain RQ2)
B9E6Y8 4.59e-17 76 34 2 146 3 greA Transcription elongation factor GreA Macrococcus caseolyticus (strain JCSC5402)
Q057J4 4.64e-17 76 36 2 132 3 greA Transcription elongation factor GreA Buchnera aphidicola subsp. Cinara cedri (strain Cc)
A8MLU4 5.16e-17 76 35 2 151 3 greA Transcription elongation factor GreA Alkaliphilus oremlandii (strain OhILAs)
P64277 6.4e-17 76 32 2 155 3 greA Transcription elongation factor GreA Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
B8DE15 6.4e-17 76 32 2 155 3 greA Transcription elongation factor GreA Listeria monocytogenes serotype 4a (strain HCC23)
Q71ZH4 6.4e-17 76 32 2 155 3 greA Transcription elongation factor GreA Listeria monocytogenes serotype 4b (strain F2365)
C1KVE3 6.4e-17 76 32 2 155 3 greA Transcription elongation factor GreA Listeria monocytogenes serotype 4b (strain CLIP80459)
P64278 6.4e-17 76 32 2 155 3 greA Transcription elongation factor GreA Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q9KDD7 6.52e-17 76 33 1 154 3 greA Transcription elongation factor GreA Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
P78019 7.04e-17 76 35 3 141 3 greA Transcription elongation factor GreA Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q6HDE6 8.97e-17 75 32 2 152 3 greA Transcription elongation factor GreA Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q634G5 8.97e-17 75 32 2 152 3 greA Transcription elongation factor GreA Bacillus cereus (strain ZK / E33L)
Q81LK9 8.97e-17 75 32 2 152 3 greA Transcription elongation factor GreA Bacillus anthracis
C3L5Y5 8.97e-17 75 32 2 152 3 greA Transcription elongation factor GreA Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P968 8.97e-17 75 32 2 152 3 greA Transcription elongation factor GreA Bacillus anthracis (strain A0248)
Q817Z6 1.61e-16 75 33 2 152 3 greA Transcription elongation factor GreA Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
A5IYH4 3.13e-16 74 32 2 148 3 greA Transcription elongation factor GreA Mycoplasmopsis agalactiae (strain NCTC 10123 / CIP 59.7 / PG2)
A7GT58 3.25e-16 74 32 2 152 3 greA Transcription elongation factor GreA Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
B9IYE4 6.7e-16 73 32 2 152 3 greA Transcription elongation factor GreA Bacillus cereus (strain Q1)
B7HQD7 6.7e-16 73 32 2 152 3 greA Transcription elongation factor GreA Bacillus cereus (strain AH187)
Q730F5 6.7e-16 73 32 2 152 3 greA Transcription elongation factor GreA Bacillus cereus (strain ATCC 10987 / NRS 248)
A2RIW3 8.1e-16 73 34 2 158 3 greA Transcription elongation factor GreA Lactococcus lactis subsp. cremoris (strain MG1363)
A5UPG5 8.73e-16 73 32 1 150 3 greA Transcription elongation factor GreA Roseiflexus sp. (strain RS-1)
B2UXU9 8.75e-16 73 32 2 155 3 greA Transcription elongation factor GreA Clostridium botulinum (strain Alaska E43 / Type E3)
Q030Z7 1.41e-15 72 33 2 158 3 greA Transcription elongation factor GreA Lactococcus lactis subsp. cremoris (strain SK11)
Q0SQ85 2.18e-15 72 33 3 155 3 greA Transcription elongation factor GreA Clostridium perfringens (strain SM101 / Type A)
Q8XHL7 2.18e-15 72 33 3 155 3 greA Transcription elongation factor GreA Clostridium perfringens (strain 13 / Type A)
Q0TMI6 2.18e-15 72 33 3 155 3 greA Transcription elongation factor GreA Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
A6LPL4 2.61e-15 72 33 2 155 3 greA Transcription elongation factor GreA Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
A8FFL6 3.7e-15 71 37 2 129 3 greA Transcription elongation factor GreA Bacillus pumilus (strain SAFR-032)
B7ID86 4.38e-15 71 31 2 150 3 greA Transcription elongation factor GreA Thermosipho africanus (strain TCF52B)
B2GD90 4.48e-15 71 31 1 154 3 greA Transcription elongation factor GreA Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
Q7UVA0 7e-15 70 28 2 160 3 greA Transcription elongation factor GreA Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
B3ESB4 7.22e-15 70 29 1 157 3 greA Transcription elongation factor GreA Amoebophilus asiaticus (strain 5a2)
B3PM73 2e-14 69 32 2 140 3 greA Transcription elongation factor GreA Metamycoplasma arthritidis (strain 158L3-1)
P47524 4.01e-14 68 32 2 140 3 greA Transcription elongation factor GreA Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
A6LMS3 1.02e-13 67 30 2 150 3 greA Transcription elongation factor GreA Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429)
Q9CHT2 5.81e-13 65 34 2 158 3 greA Transcription elongation factor GreA Lactococcus lactis subsp. lactis (strain IL1403)
Q04EK0 5.83e-13 65 29 2 143 3 greA Transcription elongation factor GreA Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q5M638 5.91e-13 65 30 1 153 3 greA Transcription elongation factor GreA Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5M1J6 5.91e-13 65 30 1 153 3 greA Transcription elongation factor GreA Streptococcus thermophilus (strain CNRZ 1066)
A5FJJ8 9.12e-13 65 27 1 155 3 greA Transcription elongation factor GreA Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / BCRC 14874 / CCUG 350202 / NBRC 14942 / NCIMB 11054 / UW101)
Q3Z8E7 9.84e-13 65 28 2 151 3 greA Transcription elongation factor GreA Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195)
Q03MH4 1.04e-12 65 30 1 153 3 greA Transcription elongation factor GreA Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q0B0N4 1.61e-12 64 28 2 157 3 greA Transcription elongation factor GreA Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
B2S1W7 2.54e-12 64 28 1 139 3 greA Transcription elongation factor GreA Treponema pallidum subsp. pallidum (strain SS14)
O83063 2.54e-12 64 28 1 139 3 greA Transcription elongation factor GreA Treponema pallidum (strain Nichols)
Q98Q16 5.12e-12 63 32 2 125 3 greA Transcription elongation factor GreA Mycoplasmopsis pulmonis (strain UAB CTIP)
P64284 5.33e-12 63 35 4 153 3 greA Transcription elongation factor GreA Staphylococcus aureus (strain MW2)
A8Z4E8 5.33e-12 63 35 4 153 3 greA Transcription elongation factor GreA Staphylococcus aureus (strain USA300 / TCH1516)
Q6G8V9 5.33e-12 63 35 4 153 3 greA Transcription elongation factor GreA Staphylococcus aureus (strain MSSA476)
Q6GG93 5.33e-12 63 35 4 153 3 greA Transcription elongation factor GreA Staphylococcus aureus (strain MRSA252)
P99156 5.33e-12 63 35 4 153 1 greA Transcription elongation factor GreA Staphylococcus aureus (strain N315)
P64283 5.33e-12 63 35 4 153 3 greA Transcription elongation factor GreA Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QHF1 5.33e-12 63 35 4 153 3 greA Transcription elongation factor GreA Staphylococcus aureus (strain Newman)
Q5HFF2 5.33e-12 63 35 4 153 3 greA Transcription elongation factor GreA Staphylococcus aureus (strain COL)
Q2YT68 5.33e-12 63 35 4 153 3 greA Transcription elongation factor GreA Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5ITD5 5.33e-12 63 35 4 153 3 greA Transcription elongation factor GreA Staphylococcus aureus (strain JH9)
Q2FXW7 5.33e-12 63 35 4 153 3 greA Transcription elongation factor GreA Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FGB6 5.33e-12 63 35 4 153 3 greA Transcription elongation factor GreA Staphylococcus aureus (strain USA300)
A6U279 5.33e-12 63 35 4 153 3 greA Transcription elongation factor GreA Staphylococcus aureus (strain JH1)
A7X319 5.33e-12 63 35 4 153 3 greA Transcription elongation factor GreA Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q49Y48 5.74e-12 63 35 3 151 3 greA Transcription elongation factor GreA Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
A6H247 6.44e-12 63 26 1 155 3 greA Transcription elongation factor GreA Flavobacterium psychrophilum (strain ATCC 49511 / DSM 21280 / CIP 103535 / JIP02/86)
A9NGN4 9.9e-12 62 31 2 138 3 greA Transcription elongation factor GreA Acholeplasma laidlawii (strain PG-8A)
A9BFC0 1.14e-11 62 30 3 144 3 greA Transcription elongation factor GreA Petrotoga mobilis (strain DSM 10674 / SJ95)
Q8CSB3 2.24e-11 61 33 4 154 3 greA Transcription elongation factor GreA Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HNU0 2.24e-11 61 33 4 154 3 greA Transcription elongation factor GreA Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
O51157 2.31e-11 64 29 1 139 3 greA Transcription elongation factor GreA Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q4L6V7 2.36e-11 61 34 4 154 3 greA Transcription elongation factor GreA Staphylococcus haemolyticus (strain JCSC1435)
B9DNJ3 2.72e-11 61 33 3 153 3 greA Transcription elongation factor GreA Staphylococcus carnosus (strain TM300)
C1CSD7 9.54e-11 60 31 2 130 3 greA Transcription elongation factor GreA Streptococcus pneumoniae (strain Taiwan19F-14)
C1CLL5 9.54e-11 60 31 2 130 3 greA Transcription elongation factor GreA Streptococcus pneumoniae (strain P1031)
C1CFA2 9.54e-11 60 31 2 130 3 greA Transcription elongation factor GreA Streptococcus pneumoniae (strain JJA)
Q8DP42 9.54e-11 60 31 2 130 3 greA Transcription elongation factor GreA Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
B8ZLB8 9.54e-11 60 31 2 130 3 greA Transcription elongation factor GreA Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
C1C8A8 9.54e-11 60 31 2 130 3 greA Transcription elongation factor GreA Streptococcus pneumoniae (strain 70585)
B5E681 9.54e-11 60 31 2 130 3 greA Transcription elongation factor GreA Streptococcus pneumoniae serotype 19F (strain G54)
Q04HS9 9.54e-11 60 31 2 130 3 greA Transcription elongation factor GreA Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q8DY80 9.84e-11 60 31 2 132 3 greA Transcription elongation factor GreA Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E3U5 9.84e-11 60 31 2 132 3 greA Transcription elongation factor GreA Streptococcus agalactiae serotype III (strain NEM316)
Q3JZS3 9.84e-11 60 31 2 132 3 greA Transcription elongation factor GreA Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
B2TI25 1.1e-10 60 33 2 133 3 greA Transcription elongation factor GreA Clostridium botulinum (strain Eklund 17B / Type B)
Q97PT2 1.64e-10 59 31 2 130 3 greA Transcription elongation factor GreA Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
A8AVM5 2.57e-10 58 32 1 129 3 greA Transcription elongation factor GreA Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
A3CPS3 2.82e-10 58 31 1 129 3 greA Transcription elongation factor GreA Streptococcus sanguinis (strain SK36)
A4VX43 6.62e-10 57 30 1 129 3 greA Transcription elongation factor GreA Streptococcus suis (strain 05ZYH33)
A4W3E8 6.62e-10 57 30 1 129 3 greA Transcription elongation factor GreA Streptococcus suis (strain 98HAH33)
Q8DSP7 9.92e-10 57 29 2 132 3 greA Transcription elongation factor GreA Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
B1ICT9 1.1e-09 57 30 2 130 3 greA Transcription elongation factor GreA Streptococcus pneumoniae (strain Hungary19A-6)
P0DB47 8.72e-09 54 28 1 129 3 greA Transcription elongation factor GreA Streptococcus pyogenes serotype M3 (strain SSI-1)
A2RGA4 8.72e-09 54 28 1 129 3 greA Transcription elongation factor GreA Streptococcus pyogenes serotype M5 (strain Manfredo)
P64287 8.72e-09 54 28 1 129 3 greA Transcription elongation factor GreA Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5XDQ7 8.72e-09 54 28 1 129 1 greA Transcription elongation factor GreA Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DB46 8.72e-09 54 28 1 129 3 greA Transcription elongation factor GreA Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P64285 8.72e-09 54 28 1 129 3 greA Transcription elongation factor GreA Streptococcus pyogenes serotype M1
Q9ADK2 1.34e-08 54 26 2 141 3 greA Transcription elongation factor GreA Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q9PLU1 1.53e-08 56 26 0 131 3 greA Transcription elongation factor GreA Chlamydia muridarum (strain MoPn / Nigg)
Q9PQI7 1.85e-08 53 29 2 118 3 greA Transcription elongation factor GreA Ureaplasma parvum serovar 3 (strain ATCC 700970)
B1AIU2 1.85e-08 53 29 2 118 3 greA Transcription elongation factor GreA Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736)
Q9Z7G4 4.74e-08 54 25 0 133 3 greA Transcription elongation factor GreA Chlamydia pneumoniae
B9DTR1 5.4e-08 52 29 1 129 3 greA Transcription elongation factor GreA Streptococcus uberis (strain ATCC BAA-854 / 0140J)
B5ZBB2 1.78e-07 51 27 2 118 3 greA Transcription elongation factor GreA Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western)
O84641 3.08e-07 52 27 1 135 3 greA Transcription elongation factor GreA Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
Q82I57 4.68e-07 50 26 3 146 3 greA Transcription elongation factor GreA Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
A0R2X1 2.42e-06 48 29 5 150 1 greA Transcription elongation factor GreA Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
A4F866 6.88e-06 47 27 5 156 3 greA Transcription elongation factor GreA Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
C1A2Y4 9.73e-06 46 28 4 150 3 greA Transcription elongation factor GreA Rhodococcus erythropolis (strain PR4 / NBRC 100887)
A1TE43 1.99e-05 45 27 5 151 3 greA Transcription elongation factor GreA Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
P65096 0.000498 42 28 3 120 4 BQ2027_MB3817 Uncharacterized protein Mb3817 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WKW7 0.000498 42 28 3 120 1 Rv3788 Uncharacterized protein Rv3788 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WKW6 0.000498 42 28 3 120 4 MT3896 Uncharacterized protein MT3896 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
B1MKJ7 0.000705 41 27 5 152 3 greA Transcription elongation factor GreA Mycobacteroides abscessus (strain ATCC 19977 / DSM 44196 / CCUG 20993 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543 / L948)
P46808 0.000834 41 26 4 150 3 greA Transcription elongation factor GreA Mycobacterium leprae (strain TN)
B8ZT53 0.000834 41 26 4 150 3 greA Transcription elongation factor GreA Mycobacterium leprae (strain Br4923)
P9WMT9 0.001 41 26 4 150 1 greA Transcription elongation factor GreA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WMT8 0.001 41 26 4 150 3 greA Transcription elongation factor GreA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U1C6 0.001 41 26 4 150 3 greA Transcription elongation factor GreA Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1AM72 0.001 41 26 4 150 3 greA Transcription elongation factor GreA Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KHL8 0.001 41 26 4 150 3 greA Transcription elongation factor GreA Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P64280 0.001 41 26 4 150 3 greA Transcription elongation factor GreA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS14450
Feature type CDS
Gene greB
Product transcription elongation factor GreB
Location 119346 - 119831 (strand: 1)
Length 486 (nucleotides) / 161 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000004
Length 258164 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1672
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01272 Transcription elongation factor, GreA/GreB, C-term
PF03449 Transcription elongation factor, N-terminal

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0782 Transcription (K) K Transcription elongation factor, GreA/GreB family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K04760 transcription elongation factor GreB - -

Protein Sequence

MAKSNLITRMGWDTLDKELKYLWKTERPQVTQAVSEAAAQGDRSENAEYIYGKKRLREIDRRIRFLAKRLDSLKIVDPDPRQEGKVFFGAWVTLENDDEEIKTFRIVGPDEFSPAKKWISVDSPVARALIGKQADDEITVITPDGEVNYVVLSIRYQPVTE

Flanking regions ( +/- flanking 50bp)

ATTTCGTATTACAATTTATTTAAATAATTTACTATTTGTTTAGGTAATATATGGCAAAAAGTAACCTCATTACCCGTATGGGATGGGATACACTGGATAAAGAGCTTAAATATCTCTGGAAAACGGAGCGTCCGCAGGTCACTCAGGCCGTGTCAGAAGCGGCTGCACAAGGGGATCGCTCTGAAAACGCTGAGTATATATACGGAAAAAAGCGTCTGCGTGAAATAGACCGGAGAATCCGTTTTCTTGCAAAACGTCTGGATAGTTTAAAGATAGTTGATCCTGATCCCCGCCAGGAAGGAAAGGTATTCTTCGGGGCGTGGGTCACGCTTGAAAATGATGATGAAGAAATTAAGACTTTTCGCATCGTAGGACCTGATGAGTTTTCACCGGCAAAGAAATGGATTTCTGTGGATTCCCCTGTGGCCCGGGCATTAATCGGCAAGCAGGCGGATGATGAAATAACAGTAATAACACCTGACGGCGAAGTAAATTACGTCGTTTTATCTATTCGGTATCAGCCCGTCACTGAATAAACGAAATAACCTGAGTATTTGTATGCAAAAACGAATCTGGAGAGTCAAAC