Homologs in group_1670

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_10725 FBDBKF_10725 93.3 Morganella morganii S1 feoA ferrous iron transporter A
EHELCC_15060 EHELCC_15060 93.3 Morganella morganii S2 feoA ferrous iron transporter A
NLDBIP_14890 NLDBIP_14890 93.3 Morganella morganii S4 feoA ferrous iron transporter A
LHKJJB_14455 LHKJJB_14455 93.3 Morganella morganii S3 feoA ferrous iron transporter A
HKOGLL_13075 HKOGLL_13075 93.3 Morganella morganii S5 feoA ferrous iron transporter A
PMI_RS14435 PMI_RS14435 72.0 Proteus mirabilis HI4320 feoA ferrous iron transporter A

Distribution of the homologs in the orthogroup group_1670

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1670

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AEL3 6.46e-31 106 69 0 73 1 feoA Fe(2+) transport protein A Escherichia coli (strain K12)
P0AEL4 6.46e-31 106 69 0 73 3 feoA Fe(2+) transport protein A Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEL5 6.46e-31 106 69 0 73 3 feoA Fe(2+) transport protein A Escherichia coli O157:H7

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS14440
Feature type CDS
Gene feoA
Product ferrous iron transporter A
Location 116198 - 116425 (strand: -1)
Length 228 (nucleotides) / 75 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000004
Length 258164 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1670
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04023 FeoA domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1918 Inorganic ion transport and metabolism (P) P Fe2+ transport protein FeoA

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K04758 ferrous iron transport protein A - -

Protein Sequence

MTLLPQHSYKILGFSNQISPAYRQKLLSLGMLPGSVFRVIRSAPLGDPIQIETRHVNLMLRKKDLALLTLDNVPA

Flanking regions ( +/- flanking 50bp)

GATAATTATTCTCAATATCATTTCAGTTTGTATGGTTAACGGGAGCCCTTATGACACTTTTGCCACAACACAGTTATAAAATCCTGGGCTTTTCCAACCAAATCAGCCCGGCCTACCGTCAAAAATTATTGTCACTGGGCATGCTGCCCGGTTCCGTTTTCCGGGTGATACGCAGCGCTCCGCTGGGTGATCCGATCCAAATCGAAACCCGGCACGTCAACCTGATGCTCAGGAAAAAAGATCTGGCGCTGCTCACGCTTGATAATGTACCGGCATAATCCGCCGCACCATTATCACTGACGCAGTCTTTTCCCTCCGCCCCCGGAGG