Homologs in group_3081

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_18855 FBDBKF_18855 97.1 Morganella morganii S1 cbiM energy-coupling factor ABC transporter permease
EHELCC_17050 EHELCC_17050 97.1 Morganella morganii S2 cbiM energy-coupling factor ABC transporter permease
NLDBIP_18430 NLDBIP_18430 97.1 Morganella morganii S4 cbiM energy-coupling factor ABC transporter permease
LHKJJB_09195 LHKJJB_09195 97.1 Morganella morganii S3 cbiM energy-coupling factor ABC transporter permease
HKOGLL_08745 HKOGLL_08745 97.1 Morganella morganii S5 cbiM energy-coupling factor ABC transporter permease

Distribution of the homologs in the orthogroup group_3081

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3081

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q05594 1.8e-129 369 73 0 238 1 cbiM Cobalt transport protein CbiM Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
D3UMA1 5.43e-104 304 64 2 234 3 cbiM Cobalt transport protein CbiM Listeria seeligeri serovar 1/2b (strain ATCC 35967 / DSM 20751 / CCM 3970 / CCUG 15530 / CIP 100100 / LMG 11386 / NCTC 11856 / SLCC 3954 / 1120)
A3CL70 8.78e-90 268 58 1 225 3 cbiM Cobalt transport protein CbiM Streptococcus sanguinis (strain SK36)
C9YID6 1.55e-89 267 59 1 223 3 cbiM Cobalt transport protein CbiM Clostridioides difficile (strain R20291)
A5VM74 1.61e-88 265 54 2 236 3 cbiM Cobalt transport protein CbiM Limosilactobacillus reuteri (strain DSM 20016)
B3EC54 1.28e-82 250 59 1 219 3 cbiM Cobalt transport protein CbiM Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
E3PSD4 4.12e-81 246 55 1 226 3 cbiM Cobalt transport protein CbiM Acetoanaerobium sticklandii (strain ATCC 12662 / DSM 519 / JCM 1433 / CCUG 9281 / NCIMB 10654 / HF)
B7GLU2 8.64e-81 245 55 2 234 3 cbiM Cobalt transport protein CbiM Anoxybacillus flavithermus (strain DSM 21510 / WK1)
A6LKX5 1.48e-80 244 55 2 220 3 cbiM Cobalt transport protein CbiM Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429)
D5AUZ9 6.09e-79 239 57 0 215 1 cbiM Cobalt transport protein CbiM Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q3AE25 9.19e-78 237 57 1 214 3 cbiM Cobalt transport protein CbiM Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
B8I0P7 1.27e-77 237 51 1 222 3 cbiM Cobalt transport protein CbiM Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
Q897L1 1.49e-77 237 50 4 235 3 cbiM Cobalt transport protein CbiM Clostridium tetani (strain Massachusetts / E88)
Q2RJ53 2.31e-75 232 55 0 210 3 cbiM Cobalt transport protein CbiM Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
A5UQS9 3.23e-75 231 55 2 218 3 cbiM Cobalt transport protein CbiM Roseiflexus sp. (strain RS-1)
D5WSC8 5e-75 230 52 1 229 3 cbiM Cobalt transport protein CbiM Kyrpidia tusciae (strain DSM 2912 / NBRC 15312 / T2)
A9KP98 1.36e-74 229 52 1 228 3 cbiM Cobalt transport protein CbiM Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
D9S0S1 3.8e-74 228 51 0 218 3 cbiM Cobalt transport protein CbiM Thermosediminibacter oceani (strain ATCC BAA-1034 / DSM 16646 / JW/IW-1228P)
D1AFI6 4.31e-74 228 53 1 213 3 cbiM Cobalt transport protein CbiM Sebaldella termitidis (strain ATCC 33386 / NCTC 11300)
D9SNZ5 1.09e-73 228 49 0 211 3 cbiM Cobalt transport protein CbiM Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B)
A4J832 1.35e-73 227 56 1 210 3 cbiM Cobalt transport protein CbiM Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
O54190 1.37e-73 226 57 0 208 3 cbiM Cobalt transport protein CbiM Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q8DG81 4.48e-72 223 50 0 217 3 cbiM Cobalt transport protein CbiM Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
B8GEB7 1.14e-71 221 52 0 206 3 cbiM2 Putative cobalt transport protein CbiM 2 Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c)
D9QVP6 1.21e-71 222 52 2 219 3 cbiM Cobalt transport protein CbiM Acetohalobium arabaticum (strain ATCC 49924 / DSM 5501 / Z-7288)
Q2NHA4 1.88e-71 221 48 2 221 3 cbiM Putative cobalt transport protein CbiM Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3)
O29530 7.19e-71 219 52 3 219 3 cbiM Putative cobalt transport protein CbiM Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
A1ANE2 4.66e-70 217 52 0 208 3 cbiM2 Cobalt transport protein CbiM 2 Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
A1ANC7 5.8e-70 217 52 0 208 3 cbim1 Cobalt transport protein CbiM 1 Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
Q58491 1.42e-69 216 52 1 206 3 cbiM Putative cobalt transport protein CbiM Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q8YQ91 1.34e-68 214 58 0 211 3 cbiM Cobalt transport protein CbiM Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
D7DR00 5.83e-66 206 51 3 209 3 cbiM Putative cobalt transport protein CbiM Methanococcus voltae (strain ATCC BAA-1334 / A3)
B8GJG9 6.3e-66 207 48 1 215 3 cbiM1 Putative cobalt transport protein CbiM 1 Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c)
Q46AL8 2.12e-65 206 47 1 212 3 cbiM2 Putative cobalt transport protein CbiM 2 Methanosarcina barkeri (strain Fusaro / DSM 804)
Q46D59 3.93e-64 202 49 0 206 3 cbiM1 Putative cobalt transport protein CbiM 1 Methanosarcina barkeri (strain Fusaro / DSM 804)
B0R611 5.12e-64 201 53 4 199 3 cbiM Putative cobalt transport protein CbiM Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
A2SSE8 8.33e-64 201 52 3 209 3 cbiM2 Putative cobalt transport protein CbiM 2 Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z)
D7GIS1 4.99e-61 194 47 0 206 3 cbiM Cobalt transport protein CbiM Propionibacterium freudenreichii subsp. shermanii (strain ATCC 9614 / DSM 4902 / CIP 103027 / NCIMB 8099 / CIRM-BIA1)
Q18J48 4.09e-58 186 53 5 219 3 cbiM Putative cobalt transport protein CbiM Haloquadratum walsbyi (strain DSM 16790 / HBSQ001)
A2SQF0 2.97e-47 159 48 1 166 3 cbiM1 Putative cobalt transport protein CbiM 1 Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z)
A2SSD6 9.39e-46 164 45 3 211 3 cbiMQ Putative fused cobalt transport protein CbiMQ Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z)
Q748J7 6.74e-41 146 38 4 226 3 cbiM Cobalt transport protein CbiM Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
A9GQ89 7.4e-31 117 35 3 212 3 cbiM Cobalt transport protein CbiM Sorangium cellulosum (strain So ce56)
Q58964 8.47e-15 74 34 2 130 3 MJ1569 Putative metal transport protein MJ1569 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
O28435 6.87e-13 70 31 4 191 3 AF_1843 Putative fused nickel transport protein NikMN Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
F9USS7 3.67e-11 65 27 1 138 2 larMN Probable fused nickel transport protein LarMN Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
D5AQY8 7.09e-10 61 32 4 158 1 nikMN Fused nickel transport protein NikMN Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q18EC4 1.95e-09 59 29 4 201 3 cbiM Putative metal transport protein HQ_3621A Haloquadratum walsbyi (strain DSM 16790 / HBSQ001)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS13740
Feature type CDS
Gene -
Product energy-coupling factor ABC transporter permease
Location 382753 - 383487 (strand: 1)
Length 735 (nucleotides) / 244 (amino acids)

Contig

Accession term accessions NZ_VXKB01000003 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 425895 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3081
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF01891 Cobalt uptake substrate-specific transmembrane region

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0310 Inorganic ion transport and metabolism (P) P ABC-type Co2+ transport system, permease component

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02007 cobalt/nickel transport system permease protein ABC transporters -

Protein Sequence

MQQKLTQFSLTGAAVTILLMIAPQEAFAMHIMEGFLPPMWAIAWWLIFLPFLVAGIVRLKAIVQEDANQKVLLALCGAFIFVLSALKIPSVTGSCSHPTGVALAVILFGPSVVAVLGSIVLLFQALMLAHGGLTTLGANGMSMAVIGPMVGYLIWRFTTKLGWRKDVCVFLVAVFADLTTYFVTSVQLGVAFPDPQMGMGAAILKFMSIFCLTQVPIAIAEGLLTVMVYDQLVKRNLVGNEVRA

Flanking regions ( +/- flanking 50bp)

TCTCAACGGTATTAATTAATAAAACCCGGAAATAATTCGGTGAGGTTGTTATGCAACAGAAACTCACGCAGTTCTCGTTAACCGGTGCCGCCGTCACAATTTTGCTGATGATCGCACCTCAGGAAGCCTTTGCCATGCATATCATGGAAGGCTTTTTACCGCCGATGTGGGCGATTGCCTGGTGGCTGATTTTCCTGCCGTTCCTTGTGGCAGGGATTGTCCGTCTCAAAGCGATTGTTCAGGAAGATGCCAACCAGAAAGTGCTGCTGGCGCTGTGCGGCGCATTTATCTTTGTGCTCTCCGCACTGAAGATCCCGTCAGTCACCGGAAGCTGCTCTCACCCGACCGGGGTGGCGCTGGCGGTTATTCTGTTCGGACCGTCAGTTGTGGCGGTGCTCGGCTCTATTGTTCTGTTGTTCCAGGCACTGATGCTGGCACACGGCGGGCTGACCACACTCGGTGCCAATGGCATGTCGATGGCGGTTATCGGCCCGATGGTCGGTTATCTCATCTGGCGTTTCACCACCAAACTCGGCTGGCGTAAAGATGTCTGCGTCTTCCTTGTGGCAGTGTTTGCCGATCTGACCACCTACTTTGTCACCTCTGTTCAGCTCGGTGTCGCCTTTCCTGATCCGCAAATGGGCATGGGTGCGGCTATCCTGAAATTCATGAGTATTTTCTGTCTGACTCAGGTGCCGATTGCCATTGCTGAAGGTCTGCTCACTGTGATGGTTTATGACCAGTTAGTGAAACGAAACCTGGTGGGAAATGAGGTACGGGCATGAAAAAGACACTGATTTTACTGTTTCTGACCATCGCTATTTTTATCATCCCG