Homologs in group_3092

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_18910 FBDBKF_18910 88.1 Morganella morganii S1 cbiB adenosylcobinamide-phosphate synthase CbiB
EHELCC_17105 EHELCC_17105 88.1 Morganella morganii S2 cbiB adenosylcobinamide-phosphate synthase CbiB
NLDBIP_18485 NLDBIP_18485 88.1 Morganella morganii S4 cbiB adenosylcobinamide-phosphate synthase CbiB
LHKJJB_09140 LHKJJB_09140 88.1 Morganella morganii S3 cbiB adenosylcobinamide-phosphate synthase CbiB
HKOGLL_08690 HKOGLL_08690 88.1 Morganella morganii S5 cbiB adenosylcobinamide-phosphate synthase CbiB

Distribution of the homologs in the orthogroup group_3092

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3092

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A8AEP3 5.68e-145 414 64 0 314 3 cobD Cobalamin biosynthesis protein CobD Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A9MLR0 1.33e-138 397 63 0 308 3 cbiB Cobalamin biosynthesis protein CbiB Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A6TDC6 3.97e-138 396 66 0 308 3 cobD Cobalamin biosynthesis protein CobD Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A9MT86 1.75e-129 374 62 0 308 3 cbiB Cobalamin biosynthesis protein CbiB Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
A1JTR6 2.56e-129 374 62 0 295 3 cobD Cobalamin biosynthesis protein CobD Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q7N2S6 3.45e-129 374 61 0 302 3 cobD Cobalamin biosynthesis protein CobD Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q57MW3 4.06e-129 374 62 0 308 3 cbiB Cobalamin biosynthesis protein CbiB Salmonella choleraesuis (strain SC-B67)
Q05600 4.76e-127 368 62 0 302 3 cbiB Cobalamin biosynthesis protein CbiB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z5M7 2.85e-126 366 63 0 308 3 cbiB Cobalamin biosynthesis protein CbiB Salmonella typhi
Q5PDS9 4.18e-126 366 62 0 308 3 cbiB Cobalamin biosynthesis protein CbiB Salmonella paratyphi A (strain ATCC 9150 / SARB42)
A3CL57 2.39e-99 298 48 1 316 3 cobD Cobalamin biosynthesis protein CobD Streptococcus sanguinis (strain SK36)
Q92CL6 1.85e-96 290 46 3 318 3 cobD Cobalamin biosynthesis protein CobD Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q8Y7S9 6.48e-96 289 47 1 314 3 cobD Cobalamin biosynthesis protein CobD Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q720N7 8.88e-96 289 46 1 314 3 cobD Cobalamin biosynthesis protein CobD Listeria monocytogenes serotype 4b (strain F2365)
Q8XLK2 4.54e-87 266 41 1 317 3 cobD Cobalamin biosynthesis protein CobD Clostridium perfringens (strain 13 / Type A)
Q897L3 1.13e-83 258 41 3 314 3 cobD Cobalamin biosynthesis protein CobD Clostridium tetani (strain Massachusetts / E88)
Q39YE5 1.32e-78 245 47 1 305 3 cobD Cobalamin biosynthesis protein CobD Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
A1AMC9 1.36e-74 235 45 3 294 3 cobD Cobalamin biosynthesis protein CobD Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
Q8EXQ8 3.4e-73 231 40 1 305 3 cobD Cobalamin biosynthesis protein CobD Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q75FR2 3.4e-73 231 40 1 305 3 cobD Cobalamin biosynthesis protein CobD Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q97LH9 7.69e-70 223 40 1 282 3 cobD Cobalamin biosynthesis protein CobD Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q8KDV4 6.74e-64 207 42 3 317 3 cobD Cobalamin biosynthesis protein CobD Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q6ALU7 1.18e-61 202 41 6 314 3 cobD Cobalamin biosynthesis protein CobD Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q9KCI3 6.28e-61 199 41 3 292 3 cobD Cobalamin biosynthesis protein CobD Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
P74475 2.64e-60 199 40 3 291 3 cobD Cobalamin biosynthesis protein CobD Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q92P50 1.49e-54 183 39 4 297 3 cobD Cobalamin biosynthesis protein CobD Rhizobium meliloti (strain 1021)
D5AV16 8.86e-54 181 38 6 299 3 cobD Cobalamin biosynthesis protein CobD Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
P21634 3.7e-53 180 37 4 299 3 cobD Cobalamin biosynthesis protein CobD Sinorhizobium sp.
P0CY56 4.05e-53 179 37 6 299 3 cobD Cobalamin biosynthesis protein CobD Rhodobacter capsulatus
C3MDQ7 9.35e-50 171 36 5 326 3 cobD Cobalamin biosynthesis protein CobD Sinorhizobium fredii (strain NBRC 101917 / NGR234)
O27460 1.77e-49 169 36 5 294 3 cobD Probable cobalamin biosynthesis protein CobD Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
A6X053 2.07e-49 170 39 3 272 3 cobD Cobalamin biosynthesis protein CobD Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q8G022 8.33e-48 166 36 4 313 3 cobD Cobalamin biosynthesis protein CobD Brucella suis biovar 1 (strain 1330)
Q3ZX56 4.13e-46 161 34 5 314 3 cobD Cobalamin biosynthesis protein CobD Dehalococcoides mccartyi (strain CBDB1)
Q8YHT9 4.26e-46 161 36 3 298 3 cobD Cobalamin biosynthesis protein CobD Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q9I469 2.38e-42 151 36 5 293 3 cobD Cobalamin biosynthesis protein CobD Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q1GDE9 1.93e-41 149 33 7 298 3 cobD Cobalamin biosynthesis protein CobD Ruegeria sp. (strain TM1040)
P9WP93 7.29e-41 147 34 4 308 1 cobD Cobalamin biosynthesis protein CobD Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q97CS1 7.9e-41 147 33 5 302 3 cobD Probable cobalamin biosynthesis protein CobD Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1)
P9WP92 8.02e-41 147 34 4 308 3 cobD Cobalamin biosynthesis protein CobD Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q7VEN1 8.11e-41 147 34 4 308 3 cobD Cobalamin biosynthesis protein CobD Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q9HLZ7 1.35e-40 146 31 4 304 3 cobD Probable cobalamin biosynthesis protein CobD Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165)
Q5LNI0 4.6e-40 145 36 8 297 3 cobD Cobalamin biosynthesis protein CobD Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q8U403 8.64e-40 144 31 6 305 3 cobD Probable cobalamin biosynthesis protein CobD Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
O58114 1.44e-39 143 36 7 258 3 cobD Probable cobalamin biosynthesis protein CobD Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q7NXQ1 7.11e-39 142 36 6 298 3 cobD Cobalamin biosynthesis protein CobD Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
A0B5W6 1.42e-38 141 29 6 305 3 cobD Probable cobalamin biosynthesis protein CobD Methanothrix thermoacetophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT)
Q58710 5.72e-38 140 31 3 260 3 cobD Probable cobalamin biosynthesis protein CobD Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
O28933 7.29e-38 139 31 5 292 3 cobD Probable cobalamin biosynthesis protein CobD Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
A4VJ38 5.94e-37 137 37 3 237 3 cobD Cobalamin biosynthesis protein CobD Stutzerimonas stutzeri (strain A1501)
Q9V2M8 3.38e-36 134 34 9 269 3 cobD Probable cobalamin biosynthesis protein CobD Pyrococcus abyssi (strain GE5 / Orsay)
Q5JI24 9.33e-35 131 31 7 298 3 cobD Probable cobalamin biosynthesis protein CobD Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
A6UNS5 8.24e-32 124 28 4 264 3 cobD Probable cobalamin biosynthesis protein CobD Methanococcus vannielii (strain ATCC 35089 / DSM 1224 / JCM 13029 / OCM 148 / SB)
A6UUW7 4.97e-31 121 27 2 260 3 cobD Probable cobalamin biosynthesis protein CobD Methanococcus aeolicus (strain ATCC BAA-1280 / DSM 17508 / OCM 812 / Nankai-3)
Q6LYN9 7.53e-30 118 26 7 320 3 cobD Probable cobalamin biosynthesis protein CobD Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
A4FXY4 4.24e-29 116 27 5 265 3 cobD Probable cobalamin biosynthesis protein CobD Methanococcus maripaludis (strain C5 / ATCC BAA-1333)
A6VFP2 1.01e-27 112 27 2 268 3 cobD Probable cobalamin biosynthesis protein CobD Methanococcus maripaludis (strain C7 / ATCC BAA-1331)
A9GM39 8.99e-27 110 35 2 251 3 cobD Cobalamin biosynthesis protein CobD Sorangium cellulosum (strain So ce56)
Q9YAA0 4.89e-19 89 28 2 267 3 cobD Probable cobalamin biosynthesis protein CobD Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS13685
Feature type CDS
Gene cbiB
Product adenosylcobinamide-phosphate synthase CbiB
Location 373942 - 374901 (strand: 1)
Length 960 (nucleotides) / 319 (amino acids)

Contig

Accession term accessions NZ_VXKB01000003 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 425895 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3092
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF03186 CobD/Cbib protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1270 Coenzyme transport and metabolism (H) H Cobalamin biosynthesis protein CobD/CbiB

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02227 adenosylcobinamide-phosphate synthase [EC:6.3.1.10] Porphyrin metabolism
Metabolic pathways
Biosynthesis of cofactors		 Cobalamin biosynthesis, cobyrinate a,c-diamide => cobalamin

Protein Sequence

MTLLSWLLAFLLDWRLGDPEHWPHPIRWIGNAIRKTESMIRSRCRSDAALRRGGIVLWIVIVGGTWIISYAMLALAFYLETSLGWLVTVWMTYTALATRCLQDSAMRVYHALKAGNLAESREKLSWIVGRDTSELMPPQITRAVTETVAENTVDGVIAPLFFLLLGGAPLAMAYKAVNTLDSMVGYKNDKYRDIGMFSARADDVANYIPARLSWLLFTFAARILKLNNRLAYTTGLRDHANHRSPNSGWSEATVAGALGVRLGGPNTYFGQLVDKPWLGDDTREINADDILSTIRLMWVASSAALALFAVVYLLSQWIL

Flanking regions ( +/- flanking 50bp)

CAGCGTCCCGGATTACTCGATCACTGGTTCTCTCTTGCGCGGGGCGTGTTATGACACTGCTCAGCTGGCTGCTTGCCTTTCTCCTCGACTGGCGCCTCGGTGACCCGGAGCACTGGCCGCACCCTATCCGCTGGATTGGCAATGCTATCCGCAAAACAGAAAGTATGATCCGCAGCCGCTGCCGGAGTGACGCCGCACTGCGCCGGGGCGGTATCGTATTGTGGATTGTGATTGTCGGCGGCACCTGGATTATCAGCTACGCCATGCTGGCGCTGGCCTTTTATCTCGAAACCAGTCTCGGCTGGCTGGTTACTGTCTGGATGACTTACACCGCGCTGGCAACCCGCTGTTTACAGGACTCAGCCATGCGGGTGTATCACGCCCTGAAAGCCGGGAACTTAGCCGAAAGCCGCGAAAAACTCTCATGGATTGTCGGGCGGGACACCAGCGAACTGATGCCACCGCAAATCACCCGGGCAGTCACTGAAACGGTTGCAGAAAATACCGTCGATGGCGTGATAGCTCCGCTGTTCTTCTTATTACTCGGCGGCGCACCACTGGCGATGGCATACAAAGCTGTCAATACCCTGGATTCCATGGTCGGCTATAAAAATGATAAATACCGCGATATCGGGATGTTTTCCGCCCGCGCGGATGATGTTGCCAATTATATTCCGGCACGCCTGAGCTGGCTGCTGTTCACCTTTGCCGCCCGCATCTTAAAACTCAATAACCGACTCGCTTACACCACCGGACTGCGCGACCACGCCAATCACCGCAGCCCGAACAGCGGCTGGTCAGAAGCAACGGTTGCCGGTGCGCTCGGTGTCCGCCTCGGCGGTCCGAATACCTATTTTGGTCAGTTAGTTGACAAACCATGGCTCGGCGACGATACGCGGGAAATTAATGCAGACGATATTCTCAGCACCATCCGGTTGATGTGGGTTGCTTCCTCCGCCGCGCTGGCACTGTTTGCTGTCGTTTATCTTCTGTCACAGTGGATTTTGTAAGGGAAAATGATGAGTTATATACAACAACCGCAGGAAATCGAAAAAAACAG