Homologs in group_1887

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_13825 FBDBKF_13825 82.8 Morganella morganii S1 hpaC 4-hydroxyphenylacetate 3-monooxygenase, reductase component
EHELCC_11495 EHELCC_11495 82.8 Morganella morganii S2 hpaC 4-hydroxyphenylacetate 3-monooxygenase, reductase component
NLDBIP_11840 NLDBIP_11840 82.8 Morganella morganii S4 hpaC 4-hydroxyphenylacetate 3-monooxygenase, reductase component
LHKJJB_11700 LHKJJB_11700 82.8 Morganella morganii S3 hpaC 4-hydroxyphenylacetate 3-monooxygenase, reductase component
HKOGLL_10310 HKOGLL_10310 82.8 Morganella morganii S5 hpaC 4-hydroxyphenylacetate 3-monooxygenase, reductase component
PMI_RS01195 PMI_RS01195 54.7 Proteus mirabilis HI4320 hpaC 4-hydroxyphenylacetate 3-monooxygenase, reductase component

Distribution of the homologs in the orthogroup group_1887

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1887

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q57501 3.34e-69 210 61 1 163 1 hpaC 4-hydroxyphenylacetate 3-monooxygenase reductase component Escherichia coli
Q8Z7Q5 4.92e-68 207 60 1 163 3 hpaC 4-hydroxyphenylacetate 3-monooxygenase reductase component Salmonella typhi
Q8ZQ51 1.26e-67 206 60 1 163 3 hpaC 4-hydroxyphenylacetate 3-monooxygenase reductase component Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q9RPU2 1.33e-67 206 60 1 163 3 hpaC 4-hydroxyphenylacetate 3-monooxygenase reductase component Salmonella dublin
Q48441 1.79e-63 196 56 1 163 2 hpaC 4-hydroxyphenylacetate 3-monooxygenase reductase component Klebsiella oxytoca
Q9HWT6 8.49e-62 191 54 0 164 1 hpaC 4-hydroxyphenylacetate 3-monooxygenase reductase component Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q48MQ8 6.72e-47 154 50 3 155 3 rutF FMN reductase (NADH) RutF Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
A7MFX8 1.01e-46 153 49 1 153 3 rutF FMN reductase (NADH) RutF Cronobacter sakazakii (strain ATCC BAA-894)
C9Y0S2 1.42e-46 152 49 1 153 3 rutF FMN reductase (NADH) RutF Cronobacter turicensis (strain DSM 18703 / CCUG 55852 / LMG 23827 / z3032)
A8GCT2 2.39e-46 152 49 1 151 3 rutF FMN reductase (NADH) RutF Serratia proteamaculans (strain 568)
D4GEU9 3.24e-45 150 48 1 151 3 rutF FMN reductase (NADH) RutF Pantoea ananatis (strain LMG 20103)
A1JMW4 3.35e-45 149 49 1 151 3 rutF FMN reductase (NADH) RutF Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q4ZXS1 9.42e-45 148 47 1 153 3 rutF FMN reductase (NADH) RutF Pseudomonas syringae pv. syringae (strain B728a)
B7KT53 5.96e-44 146 44 1 158 3 rutF2 FMN reductase (NADH) RutF 2 Methylorubrum extorquens (strain CM4 / NCIMB 13688)
C5CN84 6.43e-44 146 49 1 153 3 rutF FMN reductase (NADH) RutF Variovorax paradoxus (strain S110)
D2NGI4 7.41e-44 145 47 1 153 3 rutF FMN reductase (NADH) RutF Escherichia coli O150:H5 (strain SE15)
Q0T627 8.08e-44 145 47 1 153 3 rutF FMN reductase (NADH) RutF Shigella flexneri serotype 5b (strain 8401)
D2AC38 8.08e-44 145 47 1 153 3 rutF FMN reductase (NADH) RutF Shigella flexneri serotype X (strain 2002017)
B7M8Z2 8.08e-44 145 47 1 153 3 rutF FMN reductase (NADH) RutF Escherichia coli O8 (strain IAI1)
B7LFB7 8.08e-44 145 47 1 153 3 rutF FMN reductase (NADH) RutF Escherichia coli (strain 55989 / EAEC)
Q0TJ60 8.17e-44 145 47 1 153 3 rutF FMN reductase (NADH) RutF Escherichia coli O6:K15:H31 (strain 536 / UPEC)
D5CZG7 9.42e-44 145 47 1 153 3 rutF FMN reductase (NADH) RutF Escherichia coli O18:K1:H7 (strain IHE3034 / ExPEC)
B7MIF4 9.42e-44 145 47 1 153 3 rutF FMN reductase (NADH) RutF Escherichia coli O45:K1 (strain S88 / ExPEC)
D5CE37 9.94e-44 145 47 1 153 3 rutF FMN reductase (NADH) RutF Enterobacter cloacae subsp. cloacae (strain ATCC 13047 / DSM 30054 / NBRC 13535 / NCTC 10005 / WDCM 00083 / NCDC 279-56)
B1LIZ8 1.03e-43 145 47 1 153 3 rutF FMN reductase (NADH) RutF Escherichia coli (strain SMS-3-5 / SECEC)
B7N3G3 1.03e-43 145 47 1 153 3 rutF FMN reductase (NADH) RutF Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B1IV90 1.03e-43 145 47 1 153 3 rutF FMN reductase (NADH) RutF Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A7ZYW2 1.03e-43 145 47 1 153 3 rutF FMN reductase (NADH) RutF Escherichia coli O9:H4 (strain HS)
D3QPK0 1.03e-43 145 47 1 153 3 rutF FMN reductase (NADH) RutF Escherichia coli O55:H7 (strain CB9615 / EPEC)
C6UFB8 1.03e-43 145 47 1 153 3 rutF FMN reductase (NADH) RutF Escherichia coli (strain B / REL606)
C6EHK0 1.03e-43 145 47 1 153 3 rutF FMN reductase (NADH) RutF Escherichia coli (strain B / BL21-DE3)
B7MQ18 1.03e-43 145 47 1 153 3 rutF FMN reductase (NADH) RutF Escherichia coli O81 (strain ED1a)
B7NLB9 1.03e-43 145 47 1 153 3 rutF FMN reductase (NADH) RutF Escherichia coli O7:K1 (strain IAI39 / ExPEC)
D3H120 1.03e-43 145 47 1 153 3 rutF FMN reductase (NADH) RutF Escherichia coli O44:H18 (strain 042 / EAEC)
C8TNB7 1.03e-43 145 47 1 153 3 rutF FMN reductase (NADH) RutF Escherichia coli O26:H11 (strain 11368 / EHEC)
A7ZKB2 1.03e-43 145 47 1 153 3 rutF FMN reductase (NADH) RutF Escherichia coli O139:H28 (strain E24377A / ETEC)
C8UMM3 1.03e-43 145 47 1 153 3 rutF FMN reductase (NADH) RutF Escherichia coli O111:H- (strain 11128 / EHEC)
C8U5G9 1.03e-43 145 47 1 153 3 rutF FMN reductase (NADH) RutF Escherichia coli O103:H2 (strain 12009 / EHEC)
Q8FJ45 1.09e-43 146 47 1 153 3 rutF FMN reductase (NADH) RutF Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A4W920 1.33e-43 145 47 1 153 3 rutF FMN reductase (NADH) RutF Enterobacter sp. (strain 638)
D3RKL5 1.55e-43 145 47 1 153 3 rutF FMN reductase (NADH) RutF Klebsiella variicola (strain At-22)
Q1RDL0 1.57e-43 145 47 1 153 3 rutF FMN reductase (NADH) RutF Escherichia coli (strain UTI89 / UPEC)
A1A9R2 1.57e-43 145 47 1 153 3 rutF FMN reductase (NADH) RutF Escherichia coli O1:K1 / APEC
A6T797 1.68e-43 145 47 1 153 3 rutF FMN reductase (NADH) RutF Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
C6UPM9 1.71e-43 145 47 1 153 3 rutF FMN reductase (NADH) RutF Escherichia coli O157:H7 (strain TW14359 / EHEC)
B5YU49 1.71e-43 145 47 1 153 3 rutF FMN reductase (NADH) RutF Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XAV0 1.71e-43 145 47 1 153 3 rutF FMN reductase (NADH) RutF Escherichia coli O157:H7
B7UNZ0 2.13e-43 144 47 1 153 3 rutF FMN reductase (NADH) RutF Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A4VQH9 2.26e-43 145 44 1 156 3 rutF FMN reductase (NADH) RutF Stutzerimonas stutzeri (strain A1501)
B5XXN5 2.27e-43 144 47 1 153 3 rutF FMN reductase (NADH) RutF Klebsiella pneumoniae (strain 342)
A9W6X8 2.68e-43 144 44 1 160 3 rutF2 FMN reductase (NADH) RutF 2 Methylorubrum extorquens (strain PA1)
P75893 3.52e-43 144 46 1 153 1 rutF FMN reductase (NADH) RutF Escherichia coli (strain K12)
B1X9C8 3.52e-43 144 46 1 153 3 rutF FMN reductase (NADH) RutF Escherichia coli (strain K12 / DH10B)
C9QZ69 3.52e-43 144 46 1 153 3 rutF FMN reductase (NADH) RutF Escherichia coli (strain ATCC 33849 / DSM 4235 / NCIMB 12045 / K12 / DH1)
C4ZQD5 3.52e-43 144 46 1 153 3 rutF FMN reductase (NADH) RutF Escherichia coli (strain K12 / MC4100 / BW2952)
D7A989 8.02e-42 141 45 1 154 3 rutF FMN reductase (NADH) RutF Ancylobacter novellus (strain ATCC 8093 / DSM 506 / JCM 20403 / CCM 1077 / IAM 12100 / NBRC 12443 / NCIMB 10456)
B9JLT5 9.48e-42 140 45 1 159 3 rutF2 FMN reductase (NADH) RutF 2 Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
Q83LK9 1.15e-40 137 45 1 149 3 rutF FMN reductase (NADH) RutF Shigella flexneri
B6I983 1.15e-40 137 45 1 149 3 rutF FMN reductase (NADH) RutF Escherichia coli (strain SE11)
Q32HQ4 1.58e-40 137 45 1 149 3 rutF FMN reductase (NADH) RutF Shigella dysenteriae serotype 1 (strain Sd197)
Q3Z3A6 3.53e-40 136 44 1 149 3 rutF FMN reductase (NADH) RutF Shigella sonnei (strain Ss046)
A9W3H7 2.2e-38 133 39 1 164 3 rutF1 FMN reductase (NADH) RutF 1 Methylorubrum extorquens (strain PA1)
B7KWT3 2.33e-38 133 41 1 153 3 rutF1 FMN reductase (NADH) RutF 1 Methylorubrum extorquens (strain CM4 / NCIMB 13688)
Q6FFZ4 3.45e-38 132 46 3 151 3 rutF FMN reductase (NADH) RutF Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
C7CM32 6.39e-38 132 40 1 153 3 rutF FMN reductase (NADH) RutF Methylorubrum extorquens (strain DSM 6343 / CIP 106787 / DM4)
B1ZB19 3.87e-37 130 39 1 164 3 rutF FMN reductase (NADH) RutF Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
B9J8R4 6.59e-37 129 45 1 144 3 rutF1 FMN reductase (NADH) RutF 1 Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
C5B0U5 3.86e-36 127 39 1 153 3 rutF FMN reductase (NADH) RutF Methylorubrum extorquens (strain ATCC 14718 / DSM 1338 / JCM 2805 / NCIMB 9133 / AM1)
Q89Q06 9.1e-36 125 43 1 158 3 rutF FMN reductase (NADH) RutF Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
A9CHR3 3.18e-35 124 43 1 157 3 rutF FMN reductase (NADH) RutF Agrobacterium fabrum (strain C58 / ATCC 33970)
O87008 3.28e-31 114 35 0 159 1 tftC NADH:FAD oxidoreductase Burkholderia cepacia
P9WND9 4.84e-17 77 25 3 162 1 hsaB Flavin-dependent monooxygenase, reductase subunit HsaB Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WND8 4.84e-17 77 25 3 162 3 hsaB Flavin-dependent monooxygenase, reductase subunit HsaB Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A1IIX5 7.72e-16 74 33 2 147 1 graD FADH(2)-dependent resorcinol hydroxylase, reductase component Rhizobium sp. (strain MTP-10005)
Q02058 8.07e-16 74 32 3 151 4 actVB Actinorhodin polyketide dimerase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
S4S3E3 9.42e-15 71 32 5 154 1 ctcQ Flavin reductase (NADH) Kitasatospora aureofaciens
Q92ZM6 2.67e-13 69 31 2 129 1 SMa0793 Probable flavin reductase Rhizobium meliloti (strain 1021)
Q0S808 8.63e-13 66 23 1 162 1 hsaB Flavin-dependent monooxygenase, reductase subunit HsaB Rhodococcus jostii (strain RHA1)
Q8RQP9 5.81e-12 63 27 4 159 1 nphA2 NADH-dependent flavin reductase Rhodococcus sp.
P54990 9.76e-12 65 29 1 131 1 ntaB FMN reductase (NADH) NtaB Aminobacter aminovorans
Q8KI76 2.59e-11 62 31 6 154 1 rbmH Flavin reductase (NADPH) Lentzea aerocolonigenes
P54994 4.92e-11 61 32 7 159 1 snaC NADH:riboflavin 5'-phosphate oxidoreductase Streptomyces pristinaespiralis
Q6F4M9 6.05e-10 58 29 3 151 1 npcB 4-nitrophenol 4-monooxygenase/4-nitrocatechol 2-monooxygenase, reductase component Rhodococcus opacus
Q9FDN6 6.51e-10 59 27 3 144 1 hrb High molecular weight rubredoxin Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q6Q0M6 7.49e-10 58 30 2 129 1 dszD NADH:FMN oxidoreductase Rhodococcus erythropolis (strain XP)
B6CDL6 1.25e-09 57 23 1 161 1 dszD NADH:FMN oxidoreductase Mycolicibacterium goodii
O29428 3.57e-09 56 24 4 164 1 feR Ferric-chelate reductase (NAD(P)H) Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
O68503 1.03e-08 55 29 2 129 1 dszD NADH:FMN oxidoreductase Rhodococcus sp. (strain ATCC 53968 / IGTS8)
P0DW80 1.03e-08 55 29 2 129 1 dszD NADH:FMN oxidoreductase Rhodococcus erythropolis
M4YFG7 1.37e-08 54 23 2 151 1 None Flavin reductase Pseudomonas putida
Q6F9F5 4.47e-08 54 25 2 139 1 tgnA Flavin-dependent trigonelline monooxygenase, reductase component Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q8GME2 3.38e-07 51 25 1 128 1 sgcE6 NADH-dependent FAD reductase Streptomyces globisporus
Q5SJP7 3.62e-06 47 25 4 152 1 TTHA0961 4-hydroxyphenylacetate 3-monooxygenase, reductase component Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q55393 7.88e-06 48 25 2 131 1 dfa1 Diflavin flavoprotein A 1 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q7CS24 5.75e-05 45 25 3 145 1 smoA FMN reductase (NADH) SmoA Agrobacterium fabrum (strain C58 / ATCC 33970)
Q8YQE2 7.38e-05 45 25 2 131 3 dfa6 Putative diflavin flavoprotein A 6 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q8YQD8 0.000242 44 25 2 122 1 dfa3 Putative diflavin flavoprotein A 3 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q8YNW5 0.000263 43 25 2 122 3 dfa1 Putative diflavin flavoprotein A 1 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q8Z0C0 0.000367 43 23 2 131 3 dfa2 Putative diflavin flavoprotein A 2 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
P74373 0.000579 43 26 3 150 1 dfa3 Putative diflavin flavoprotein A 3 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS12690
Feature type CDS
Gene hpaC
Product 4-hydroxyphenylacetate 3-monooxygenase, reductase component
Location 137372 - 137896 (strand: 1)
Length 525 (nucleotides) / 174 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000003
Length 425895 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1887
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01613 Flavin reductase like domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1853 Energy production and conversion (C) C FMN reductase RutF, DIM6/NTAB family

Kegg Ortholog Annotation(s)

Protein Sequence

MSFDNSRCLQFRDAMANLSAAVNIVTTDGEAGRAGLTATAVCSVTDNPPTLLVCINRSSALSEVFKTNGRLCVNVLTHSHQALACDFAGMTGLSMDARFSGDNWQPGQLGQPCLNNSLASLEGAVTQVQEIGTHNVFMVEIENIDVRDRGHGLIYFKRDFRVVETSETLSSAVA

Flanking regions ( +/- flanking 50bp)

GCAATATAGCAACAATTGTGTCACATTTTATTTGCTCTTCAGGAGTTGGCATGTCTTTTGATAATTCCCGGTGTCTTCAGTTCCGCGACGCAATGGCTAATCTCTCCGCTGCCGTCAATATTGTCACCACAGACGGCGAAGCCGGACGCGCCGGTCTGACAGCAACCGCTGTCTGTTCCGTCACCGATAACCCGCCGACACTGCTGGTGTGCATCAACCGGAGCAGCGCACTCAGTGAGGTTTTTAAAACCAACGGCCGCCTCTGTGTGAATGTGCTCACTCATTCCCATCAGGCTCTCGCCTGTGATTTCGCCGGGATGACAGGGCTGAGTATGGATGCCCGCTTTTCAGGTGATAACTGGCAGCCCGGTCAGCTGGGACAGCCCTGTCTGAATAACTCGCTTGCCAGCCTGGAAGGTGCGGTGACGCAGGTTCAGGAAATCGGCACGCATAACGTTTTTATGGTTGAGATTGAAAACATTGATGTGCGCGACCGGGGACACGGACTGATTTATTTTAAACGCGACTTCCGTGTGGTTGAAACCAGCGAAACCCTCTCTTCTGCCGTTGCCTGACCCTCTCTTATCAATATCCGTATTCGTTAATACTTTTTGTGTTAACGAAT