Homologs in group_3853

Help

1 homologs were identified in 1 genome with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
PMI_RS14385 PMI_RS14385 29.8 Proteus mirabilis HI4320 - phosphopantetheine-binding protein

Distribution of the homologs in the orthogroup group_3853

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3853

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q5NN07 0.00016 39 32 3 84 3 acpP Acyl carrier protein Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q0BPZ5 0.000455 38 29 3 86 3 acpP Acyl carrier protein Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
Q7M9W1 0.000843 37 25 3 77 3 acpP Acyl carrier protein Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q1GHT1 0.001 37 30 2 70 3 acpP Acyl carrier protein Ruegeria sp. (strain TM1040)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS11950
Feature type CDS
Gene -
Product phosphopantetheine-binding protein
Location 545786 - 546049 (strand: 1)
Length 264 (nucleotides) / 87 (amino acids)

Contig

Accession term accessions NZ_VXKB01000002 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 573139 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3853
Orthogroup size 2
N. genomes 2

Actions

Genomic region

Domains

PF00550 Phosphopantetheine attachment site

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0236 Lipid transport and metabolism (I) I Acyl carrier protein

Kegg Ortholog Annotation(s)

Protein Sequence

MADISSVQNALKQLIIDTLNLEDIAPDEIETDAPLFGDGLGLDSIDALELGLAIKNRYGVVLSSDSDEVRKHFYSVATLAAYIDSQK

Flanking regions ( +/- flanking 50bp)

AACTTACATAACCATTAAATTTTAGATAATCATTGGGATTTAGACTTGCTATGGCCGATATATCATCAGTGCAGAATGCATTAAAACAACTCATTATTGACACGCTGAATCTGGAAGATATTGCCCCGGACGAGATTGAAACGGATGCCCCGCTGTTTGGTGACGGGCTGGGTCTGGATTCTATCGATGCGCTGGAACTGGGACTGGCGATTAAAAACCGGTATGGCGTTGTTTTATCTTCGGACAGCGATGAAGTCCGTAAACATTTTTATTCTGTTGCCACGTTAGCAGCATATATTGACTCACAGAAATAACCGGAAATAACGATGAAACAGGAAGAACTTTATCAGGAGATCAGTCAGTT