Homologs in group_3691
2 homologs were identified in 2 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.
| Locus tag | Identity | Source | Gene | Product | |
|---|---|---|---|---|---|
| F4V73_RS11955 | F4V73_RS11955 | 31.4 | Morganella psychrotolerans | - | acyl carrier protein |
| PMI_RS14385 | PMI_RS14385 | 29.8 | Proteus mirabilis HI4320 | - | phosphopantetheine-binding protein |
Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).
| Swissprot accession | Eval | Score | ID (%) | N gaps | Alignment length | Annot score | Gene | Description | Organism |
|---|---|---|---|---|---|---|---|---|---|
| Q5NN07 | 0.00016 | 39 | 32 | 3 | 84 | 3 | acpP | Acyl carrier protein | Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) |
| Q0BPZ5 | 0.000455 | 38 | 29 | 3 | 86 | 3 | acpP | Acyl carrier protein | Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) |
| Q7M9W1 | 0.000843 | 37 | 25 | 3 | 77 | 3 | acpP | Acyl carrier protein | Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W) |
| Q1GHT1 | 0.001 | 37 | 30 | 2 | 70 | 3 | acpP | Acyl carrier protein | Ruegeria sp. (strain TM1040) |
| Source | Morganella psychrotolerans |
|---|---|
| Locus tag | F4V73_RS11950 |
| Feature type | CDS |
| Gene | - |
| Product | phosphopantetheine-binding protein |
| Location | 545786 - 546049 (strand: 1) |
| Length | 264 (nucleotides) / 87 (amino acids) |
| In genomic island | - |
| Accession | NZ_VXKB01000002 |
|---|---|
| Length | 573139 nucleotides |
| Topology | linear |
| Plasmid | False |
| Orthogroup | group_3691 | |
|---|---|---|
| Orthogroup size | 3 | |
| N. genomes | 2 |
| PF00550 | Phosphopantetheine attachment site |
|---|
| ID | Function(s) descr. | Function(s) cat. | Description |
|---|---|---|---|
| COG0236 | Lipid transport and metabolism (I) | I | Acyl carrier protein |
MADISSVQNALKQLIIDTLNLEDIAPDEIETDAPLFGDGLGLDSIDALELGLAIKNRYGVVLSSDSDEVRKHFYSVATLAAYIDSQK
AACTTACATAACCATTAAATTTTAGATAATCATTGGGATTTAGACTTGCTATGGCCGATATATCATCAGTGCAGAATGCATTAAAACAACTCATTATTGACACGCTGAATCTGGAAGATATTGCCCCGGACGAGATTGAAACGGATGCCCCGCTGTTTGGTGACGGGCTGGGTCTGGATTCTATCGATGCGCTGGAACTGGGACTGGCGATTAAAAACCGGTATGGCGTTGTTTTATCTTCGGACAGCGATGAAGTCCGTAAACATTTTTATTCTGTTGCCACGTTAGCAGCATATATTGACTCACAGAAATAACCGGAAATAACGATGAAACAGGAAGAACTTTATCAGGAGATCAGTCAGTT
