Homologs in group_2596

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_03170 FBDBKF_03170 84.5 Morganella morganii S1 tauC taurine ABC transporter permease TauC
EHELCC_07365 EHELCC_07365 84.5 Morganella morganii S2 tauC taurine ABC transporter permease TauC
NLDBIP_07690 NLDBIP_07690 84.5 Morganella morganii S4 tauC taurine ABC transporter permease TauC
LHKJJB_07225 LHKJJB_07225 84.5 Morganella morganii S3 tauC taurine ABC transporter permease TauC
HKOGLL_03705 HKOGLL_03705 84.5 Morganella morganii S5 tauC taurine ABC transporter permease TauC

Distribution of the homologs in the orthogroup group_2596

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2596

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q47539 3.17e-102 301 63 1 251 3 tauC Taurine transport system permease protein TauC Escherichia coli (strain K12)
Q2YJB4 9.84e-41 144 32 2 255 3 BAB2_1148 Probable ABC transporter permease protein BAB2_1148 Brucella abortus (strain 2308)
Q576D9 9.84e-41 144 32 2 255 3 BruAb2_1124 Probable ABC transporter permease protein BruAb2_1124 Brucella abortus biovar 1 (strain 9-941)
Q8YDR8 1.19e-40 143 33 2 252 3 BMEII0107 Probable ABC transporter permease protein BMEII0107 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q8FUN2 3.34e-40 142 32 2 255 3 BRA1188 Probable ABC transporter permease protein BRA1188/BS1330_II1179 Brucella suis biovar 1 (strain 1330)
P75851 1.87e-35 130 34 1 236 1 ssuC Putative aliphatic sulfonates transport permease protein SsuC Escherichia coli (strain K12)
P40401 7.47e-35 129 36 1 238 2 ssuC Putative aliphatic sulfonates transport permease protein SsuC Bacillus subtilis (strain 168)
Q57856 4.34e-34 127 29 1 261 3 MJ0413 Putative ABC transporter permease protein MJ0413 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q55461 1.8e-28 112 31 2 204 2 cmpB Bicarbonate transport system permease protein CmpB Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
A9WGD1 2.41e-28 112 32 1 244 1 ribX Riboflavin transport system permease protein RibX Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
Q51881 2.51e-27 109 31 1 201 3 nrtB Nitrate import permease protein NrtB Phormidium laminosum
Q5MZ55 6.77e-27 108 30 4 222 3 cmpB Bicarbonate transport system permease protein CmpB Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q55106 6.77e-27 108 30 4 222 1 cmpB Bicarbonate transport system permease protein CmpB Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
P73451 2.23e-26 107 27 2 249 3 nrtB Nitrate import permease protein NrtB Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P38044 3.35e-23 98 27 1 205 1 nrtB Nitrate import permease protein NrtB Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q57306 1.18e-17 82 25 1 245 3 HI_0355 Probable ABC transporter permease protein HI_0355 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
O34649 1.4e-17 83 21 2 242 3 ytlD Uncharacterized ABC transporter permease protein YtlD Bacillus subtilis (strain 168)
Q9K9G6 6.24e-17 81 26 3 227 3 thiX Formylaminopyrimidine transport permease protein ThiX Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q9KHT8 6.74e-15 74 26 4 201 1 opuCB Carnitine transport permease protein OpuCB Listeria monocytogenes
G2JZ43 6.74e-15 74 26 4 201 1 opuCB Carnitine transport permease protein OpuCB Listeria monocytogenes serotype 1/2a (strain 10403S)
O34742 2.39e-14 73 26 4 220 1 opuCD Glycine betaine/carnitine/choline transport system permease protein OpuCD Bacillus subtilis (strain 168)
E0SCY2 4.04e-14 74 30 1 181 1 ousW Glycine betaine/choline transport system permease protein OusW Dickeya dadantii (strain 3937)
P39775 4.43e-14 72 27 2 186 2 opuBD Choline transport system permease protein OpuBD Bacillus subtilis (strain 168)
Q8ZPK1 7.53e-14 72 30 2 140 1 osmY Osmoprotectant import permease protein OsmY Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P46921 6.22e-13 70 28 4 196 1 opuAB Glycine betaine transport system permease protein OpuAB Bacillus subtilis (strain 168)
P17327 2.37e-12 69 31 1 165 2 proW Glycine betaine/proline betaine transport system permease protein ProW Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P14176 3.66e-12 68 30 1 165 1 proW Glycine betaine/proline betaine transport system permease protein ProW Escherichia coli (strain K12)
Q9KHT6 1e-10 63 25 3 210 1 opuCD Carnitine transport permease protein OpuCD Listeria monocytogenes
G2JZ41 1e-10 63 25 3 210 1 opuCD Carnitine transport permease protein OpuCD Listeria monocytogenes serotype 1/2a (strain 10403S)
Q9RR45 1.88e-10 63 27 1 155 1 gbuB Glycine betaine/carnitine transport permease protein GbuB Listeria monocytogenes serotype 1/2a (strain 10403S)
Q4FL38 3.3e-09 60 27 1 181 1 tmoV Trimethylamine N-oxide transport system permease protein TmoV Pelagibacter ubique (strain HTCC1062)
Q4FL38 0.000247 45 21 0 128 1 tmoV Trimethylamine N-oxide transport system permease protein TmoV Pelagibacter ubique (strain HTCC1062)
A0A0H2XK79 2.58e-08 57 27 5 206 3 egtUBC Probable ergothioneine transporter EgtUBC Staphylococcus aureus (strain USA300)
Q45461 4.13e-07 52 23 5 210 2 opuBB Choline transport system permease protein OpuBB Bacillus subtilis (strain 168)
Q5LT64 4.41e-06 51 25 0 147 1 tmoV Trimethylamine N-oxide transport system permease protein TmoV Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q5LT64 3.87e-05 48 27 0 128 1 tmoV Trimethylamine N-oxide transport system permease protein TmoV Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
O34878 3.14e-05 47 22 4 194 1 opuCB Glycine betaine/carnitine/choline transport system permease protein OpuCB Bacillus subtilis (strain 168)
P33359 9.88e-05 46 28 2 178 1 yehW Glycine betaine uptake system permease protein YehW Escherichia coli (strain K12)
Q9KTJ6 0.000293 44 32 7 161 3 metI Probable D-methionine transport system permease protein MetI Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8Y775 0.000833 43 26 6 196 1 egtUBC Probable ergothioneine transporter EgtUBC Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS11750
Feature type CDS
Gene tauC
Product taurine ABC transporter permease TauC
Location 498343 - 499140 (strand: -1)
Length 798 (nucleotides) / 265 (amino acids)

Contig

Accession term accessions NZ_VXKB01000002 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 573139 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2596
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF00528 Binding-protein-dependent transport system inner membrane component

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0600 Inorganic ion transport and metabolism (P) P ABC-type nitrate/sulfonate/bicarbonate transport system, permease component

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K15552 taurine transport system permease protein Sulfur metabolism
ABC transporters		 -

Protein Sequence

MKYLSGERKARHSRILISIVSISVLIAGWWLTSTLQWVNPLYLPAPEQIGRQFLALSESGYMNATLWQHLAASLDRILQALLLAVITGIPAGVMMGLSPLIRGVLDPVIELYRPVPPLAYLPLIVIWFGIGETTKVLLIYLAILAPVLISAMQGVLAVPENRIRAVQSLGANRLQVLRYVILPSALPHIITGVRIGLGVGWSTLVAAELVAAQRGLGFMVQSAAQFLNTGIVMTGIAVIAVVALSIELALRYLQQALVPWYAKES

Flanking regions ( +/- flanking 50bp)

ATAATGCAGATGCAGAGCATATACCATATTGTCAGAAAAGAGGTCATACCATGAAATACCTATCCGGAGAGAGAAAAGCCCGGCACAGCCGGATATTAATCAGCATCGTGAGTATATCTGTACTGATAGCAGGATGGTGGCTGACAAGTACATTACAGTGGGTTAACCCGCTGTATCTGCCCGCGCCGGAACAGATCGGACGTCAGTTTCTGGCGTTATCAGAGTCCGGCTATATGAATGCCACGCTGTGGCAGCACCTGGCCGCCAGCCTGGACCGGATACTTCAGGCACTGCTCCTGGCGGTAATTACGGGGATCCCGGCGGGCGTTATGATGGGGCTGAGTCCGCTGATCCGCGGCGTGTTAGATCCTGTTATCGAACTTTATCGCCCTGTTCCCCCTCTGGCTTATCTGCCACTGATTGTTATCTGGTTTGGTATTGGTGAAACCACCAAAGTCCTGCTGATTTATCTGGCCATTCTGGCACCGGTTTTAATTTCCGCCATGCAGGGCGTTCTGGCTGTGCCGGAAAACCGGATACGGGCGGTGCAATCTCTGGGGGCAAACCGATTGCAGGTTTTAAGGTATGTGATTTTACCATCAGCATTACCGCACATCATTACCGGTGTCCGGATTGGGCTGGGTGTGGGCTGGTCAACACTGGTGGCAGCCGAGTTAGTCGCGGCACAGCGGGGACTGGGATTTATGGTGCAGTCCGCTGCACAATTTCTGAATACAGGGATTGTCATGACAGGCATTGCCGTGATTGCCGTTGTGGCGCTCAGCATTGAACTGGCACTACGTTATTTACAGCAGGCATTAGTTCCGTGGTACGCAAAAGAATCTTAAACAACCCGGGAGAACGGATATGGATATACAAAAGTTAACACCCGCTATCG