Homologs in group_737

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_03260 FBDBKF_03260 93.5 Morganella morganii S1 ptsN PTS IIA-like nitrogen regulatory protein PtsN
EHELCC_07275 EHELCC_07275 93.5 Morganella morganii S2 ptsN PTS IIA-like nitrogen regulatory protein PtsN
NLDBIP_07600 NLDBIP_07600 93.5 Morganella morganii S4 ptsN PTS IIA-like nitrogen regulatory protein PtsN
LHKJJB_07135 LHKJJB_07135 93.5 Morganella morganii S3 ptsN PTS IIA-like nitrogen regulatory protein PtsN
HKOGLL_03795 HKOGLL_03795 93.5 Morganella morganii S5 ptsN PTS IIA-like nitrogen regulatory protein PtsN
PMI_RS18140 PMI_RS18140 73.5 Proteus mirabilis HI4320 ptsN PTS IIA-like nitrogen regulatory protein PtsN

Distribution of the homologs in the orthogroup group_737

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_737

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P69815 3.63e-74 221 70 1 154 3 ptsN Nitrogen regulatory protein Shigella flexneri
P69829 3.63e-74 221 70 1 154 1 ptsN Nitrogen regulatory protein Escherichia coli (strain K12)
P17162 2.05e-73 219 69 1 155 3 ptsN Nitrogen regulatory protein Klebsiella oxytoca
P45072 4.59e-31 112 34 1 149 4 ptsN Nitrogen regulatory protein homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P30335 2.62e-27 102 37 3 151 3 ptsN Nitrogen regulatory protein Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q9HVV4 9.98e-26 98 40 4 153 3 ptsN Nitrogen regulatory protein Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
D4GYE4 7.48e-15 70 32 2 131 2 ptfA PTS system fructose-specific EIIA component Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
O31645 6.38e-14 71 32 4 150 1 manP PTS system mannose-specific EIIBCA component Bacillus subtilis (strain 168)
P32155 1.8e-10 58 28 2 138 3 frvA PTS system fructose-like EIIA component Escherichia coli (strain K12)
P33670 3.74e-10 56 39 3 91 3 ptsN Nitrogen regulatory protein (Fragment) Pseudomonas putida
P54745 2.05e-09 58 27 6 159 1 mngA PTS system 2-O-alpha-mannosyl-D-glycerate-specific EIIABC component Escherichia coli (strain K12)
P71012 8.75e-09 56 24 2 150 1 fruA PTS system fructose-specific EIIABC component Bacillus subtilis (strain 168)
Q9KM70 8.9e-06 47 28 4 132 2 fruB Multiphosphoryl transfer protein Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8K911 1.44e-05 47 25 4 135 3 mtlA PTS system mannitol-specific EIICBA component Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P69811 7.62e-05 45 25 4 142 1 fruB Multiphosphoryl transfer protein Escherichia coli (strain K12)
P69812 7.62e-05 45 25 4 142 3 fruB Multiphosphoryl transfer protein Escherichia coli O157:H7
P17127 7.92e-05 45 25 4 142 1 fruB Multiphosphoryl transfer protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z591 9.4e-05 44 25 4 142 3 fruB Multiphosphoryl transfer protein Salmonella typhi
Q9XBM7 0.00011 44 22 2 111 3 mtlA PTS system mannitol-specific EIICBA component Klebsiella pneumoniae
P77439 0.000386 43 26 3 105 1 fryA Multiphosphoryl transfer protein 1 Escherichia coli (strain K12)
P0A0D9 0.000511 41 23 4 137 3 mtlF Mannitol-specific phosphotransferase enzyme IIA component Staphylococcus aureus (strain MW2)
Q6G7F4 0.000511 41 23 4 137 3 mtlF Mannitol-specific phosphotransferase enzyme IIA component Staphylococcus aureus (strain MSSA476)
P0A0D8 0.000511 41 23 4 137 3 mtlF Mannitol-specific phosphotransferase enzyme IIA component Staphylococcus aureus (strain N315)
P0A0D7 0.000511 41 23 4 137 3 mtlF Mannitol-specific phosphotransferase enzyme IIA component Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HE46 0.000511 41 23 4 137 3 mtlF Mannitol-specific phosphotransferase enzyme IIA component Staphylococcus aureus (strain COL)
P57635 0.00081 42 25 3 106 3 mtlA PTS system mannitol-specific EIICBA component Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS11660
Feature type CDS
Gene ptsN
Product PTS IIA-like nitrogen regulatory protein PtsN
Location 483659 - 484126 (strand: -1)
Length 468 (nucleotides) / 155 (amino acids)

Contig

Accession term accessions NZ_VXKB01000002 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 573139 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_737
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00359 Phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 2

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1762 Carbohydrate transport and metabolism (G)
Signal transduction mechanisms (T)		 GT Phosphotransferase system mannitol/fructose-specific IIA domain (Ntr-type)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02806 nitrogen PTS system EIIA component [EC:2.7.1.-] Phosphotransferase system (PTS) -

Protein Sequence

MNNEANLSLSDVLSISCTRNNIHCTSKKRALEIISELAAPALNLPESTLFEALLTREKVGTTGIGGGIAIPHGKLDCNEAHKACGVFLHLEHAIAFDAIDNQNVDILFALFVPSDQCQTHLHTLSLVAKKLADKTLCRRLRQAQSDEELYSIITE

Flanking regions ( +/- flanking 50bp)

CCCGGCTGTCATCCTGGCATCCGGGATTCTGATCCTAAGTGAACAATGAAATGAATAACGAAGCAAATTTGTCCCTGAGCGATGTACTGAGTATCAGTTGCACGCGCAATAATATTCACTGCACCAGCAAAAAACGTGCACTGGAAATAATCAGTGAGCTGGCAGCCCCGGCACTGAACCTGCCGGAAAGTACGCTGTTTGAGGCACTCCTCACACGGGAAAAAGTCGGGACAACCGGTATTGGTGGCGGGATTGCTATTCCGCACGGAAAACTGGACTGCAACGAGGCACACAAAGCCTGTGGTGTGTTTTTACACCTGGAGCACGCTATCGCGTTTGATGCGATTGACAATCAGAATGTGGACATCCTGTTTGCCTTGTTTGTTCCTTCTGACCAGTGTCAGACCCATTTACACACACTGTCGTTAGTCGCAAAAAAACTTGCGGATAAAACGCTCTGCCGCCGTCTTCGTCAGGCGCAAAGCGATGAAGAGCTGTACAGTATCATCACGGAATGATATCAGCCGGCTAACGACAATGAGATAATGGCATTATGCCATTGAAAGAG