Homologs in group_760

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_03420 FBDBKF_03420 91.6 Morganella morganii S1 kdpE two-component system response regulator KdpE
EHELCC_07115 EHELCC_07115 91.6 Morganella morganii S2 kdpE two-component system response regulator KdpE
NLDBIP_07440 NLDBIP_07440 91.6 Morganella morganii S4 kdpE two-component system response regulator KdpE
LHKJJB_06975 LHKJJB_06975 91.6 Morganella morganii S3 kdpE two-component system response regulator KdpE
HKOGLL_03955 HKOGLL_03955 91.6 Morganella morganii S5 kdpE two-component system response regulator KdpE
PMI_RS05915 PMI_RS05915 63.1 Proteus mirabilis HI4320 kdpE two-component system response regulator KdpE

Distribution of the homologs in the orthogroup group_760

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_760

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P21866 4.98e-124 353 73 0 224 1 kdpE KDP operon transcriptional regulatory protein KdpE Escherichia coli (strain K12)
P9WGN1 8.09e-69 213 49 1 224 1 kdpE Transcriptional regulatory protein KdpE Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGN0 8.09e-69 213 49 1 224 3 kdpE Transcriptional regulatory protein KdpE Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q2FWH6 1.78e-52 172 40 1 222 1 kdpE Transcriptional regulatory protein KdpE Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q8DPL7 3.46e-49 164 39 2 229 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
A0A0H2UQ68 3.46e-49 164 39 2 229 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
A0A0H2ZN37 3.46e-49 164 39 2 229 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
P9WGL9 5.68e-47 157 40 1 225 1 regX3 Sensory transduction protein RegX3 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGL8 5.68e-47 157 40 1 225 2 regX3 Sensory transduction protein RegX3 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O07130 5.68e-47 157 40 1 225 1 regX3 Sensory transduction protein RegX3 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P32040 1.62e-46 157 39 3 230 3 SYNPCC7002_A0851 Probable transcriptional regulatory protein SYNPCC7002_A0851 Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
P28257 3.05e-45 154 37 2 227 3 ycf27 Probable transcriptional regulator ycf27 Galdieria sulphuraria
P48259 3.39e-45 153 37 2 227 3 ycf27 Probable transcriptional regulator ycf27 Cyanophora paradoxa
Q1B3X8 7.19e-45 152 37 3 228 3 mprA Response regulator MprA Mycobacterium sp. (strain MCS)
A1UL70 7.19e-45 152 37 3 228 3 mprA Response regulator MprA Mycobacterium sp. (strain KMS)
A3Q5L9 7.19e-45 152 37 3 228 3 mprA Response regulator MprA Mycobacterium sp. (strain JLS)
Q9F868 1.42e-44 151 39 1 226 1 regX3 Sensory transduction protein RegX3 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
A0R3I8 2.96e-44 150 36 3 228 1 mprA Response regulator MprA Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
P13792 4.6e-44 150 38 4 229 1 phoP Alkaline phosphatase synthesis transcriptional regulatory protein PhoP Bacillus subtilis (strain 168)
O78428 7.51e-44 150 38 2 227 3 ycf27 Probable transcriptional regulator ycf27 Guillardia theta
Q9TLQ4 8.41e-44 150 36 2 229 3 ycf27 Probable transcriptional regulator ycf27 Cyanidium caldarium
P28835 8.88e-44 150 36 2 227 3 ycf27 Probable transcriptional regulator ycf27 Porphyridium aerugineum
Q742C1 3.14e-43 148 36 3 226 3 mprA Response regulator MprA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QBQ9 3.14e-43 148 36 3 226 3 mprA Response regulator MprA Mycobacterium avium (strain 104)
P51358 3.3e-43 148 36 2 227 3 ycf27 Probable transcriptional regulator ycf27 Porphyra purpurea
Q1XDC9 3.52e-43 148 36 2 227 3 ycf27 Probable transcriptional regulator ycf27 Neopyropia yezoensis
A1KHB7 7.07e-43 147 35 3 228 3 mprA Response regulator MprA Mycobacterium bovis (strain BCG / Pasteur 1173P2)
Q7U0X4 7.07e-43 147 35 3 228 1 mprA Response regulator MprA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WGM9 1.19e-42 147 35 3 228 1 mprA Response regulator MprA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM8 1.19e-42 147 35 3 228 3 mprA Response regulator MprA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U123 1.19e-42 147 35 3 228 3 mprA Response regulator MprA Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
A0PWB4 1.19e-42 147 36 4 230 3 mprA Response regulator MprA Mycobacterium ulcerans (strain Agy99)
P54884 2.01e-42 145 43 1 181 3 rgx3 Sensory transduction protein RegX3 Mycobacterium leprae (strain TN)
A1TEL7 5.83e-42 145 35 3 229 3 mprA Response regulator MprA Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q4A160 4.72e-41 142 36 2 223 3 walR Transcriptional regulatory protein WalR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q9CD68 8.2e-41 142 37 4 227 3 mprA Response regulator MprA Mycobacterium leprae (strain TN)
P0C001 1.25e-40 141 35 2 221 3 arlR Response regulator ArlR Staphylococcus aureus (strain MW2)
Q6G9E6 1.25e-40 141 35 2 221 3 arlR Response regulator ArlR Staphylococcus aureus (strain MSSA476)
Q6GGZ3 1.25e-40 141 35 2 221 3 arlR Response regulator ArlR Staphylococcus aureus (strain MRSA252)
P0C000 1.25e-40 141 35 2 221 3 arlR Response regulator ArlR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HG04 1.25e-40 141 35 2 221 3 arlR Response regulator ArlR Staphylococcus aureus (strain COL)
Q2YY03 1.25e-40 141 35 2 221 3 arlR Response regulator ArlR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q9KJN4 1.25e-40 141 35 2 221 1 arlR Response regulator ArlR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH23 1.25e-40 141 35 2 221 3 arlR Response regulator ArlR Staphylococcus aureus (strain USA300)
P54443 4.48e-40 140 37 3 225 3 yrkP Uncharacterized transcriptional regulatory protein YrkP Bacillus subtilis (strain 168)
Q7A216 6.53e-40 140 34 2 227 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MW2)
Q9RDT5 6.53e-40 140 34 2 227 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus
A8YYU1 6.53e-40 140 34 2 227 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain USA300 / TCH1516)
Q6GD72 6.53e-40 140 34 2 227 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MSSA476)
Q6GKS7 6.53e-40 140 34 2 227 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MRSA252)
Q7A8E1 6.53e-40 140 34 2 227 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain N315)
Q99XF3 6.53e-40 140 34 2 227 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QD57 6.53e-40 140 34 2 227 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Newman)
Q5HJX7 6.53e-40 140 34 2 227 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain COL)
Q2YUQ3 6.53e-40 140 34 2 227 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5INQ9 6.53e-40 140 34 2 227 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain JH9)
Q2G2U6 6.53e-40 140 34 2 227 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FKN8 6.53e-40 140 34 2 227 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain USA300)
A6TXG8 6.53e-40 140 34 2 227 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain JH1)
A7WWQ5 6.53e-40 140 34 2 227 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q4L6C6 1.11e-39 139 33 2 221 3 arlR Response regulator ArlR Staphylococcus haemolyticus (strain JCSC1435)
O34903 1.36e-39 139 38 4 221 3 ykoG Uncharacterized transcriptional regulatory protein YkoG Bacillus subtilis (strain 168)
Q8CQK0 2.79e-39 138 34 2 223 3 walR Transcriptional regulatory protein WalR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HK18 2.79e-39 138 34 2 223 3 walR Transcriptional regulatory protein WalR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q4LAJ9 3.69e-39 138 34 2 223 3 walR Transcriptional regulatory protein WalR Staphylococcus haemolyticus (strain JCSC1435)
P39663 3.84e-39 138 34 4 234 1 sphR Alkaline phosphatase synthesis transcriptional regulatory protein SphR Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
P23836 7.67e-39 137 36 4 222 1 phoP Transcriptional regulatory protein PhoP Escherichia coli (strain K12)
Q83RR0 8.35e-39 136 36 4 222 3 phoP Virulence transcriptional regulatory protein PhoP Shigella flexneri
Q8CXZ9 8.35e-39 136 36 4 222 3 phoP Transcriptional regulatory protein PhoP Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8X738 1.27e-38 136 36 4 222 3 phoP Transcriptional regulatory protein PhoP Escherichia coli O157:H7
Q99U73 1.56e-38 135 35 4 223 3 arlR Response regulator ArlR Staphylococcus aureus (strain N315)
P37478 4.66e-38 135 34 1 223 1 walR Transcriptional regulatory protein WalR Bacillus subtilis (strain 168)
Q8Z7H2 9.76e-38 134 35 4 225 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhi
P0DM78 2.01e-37 133 35 4 225 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
F5ZP95 2.01e-37 133 35 4 225 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain ATCC 68169 / UK-1)
E1WFA1 2.01e-37 133 35 4 225 2 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain SL1344)
D0ZV90 2.01e-37 133 35 4 225 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain 14028s / SGSC 2262)
Q5PMJ1 2.01e-37 133 35 4 225 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella paratyphi A (strain ATCC 9150 / SARB42)
P35163 2.63e-37 133 33 2 227 1 resD Transcriptional regulatory protein ResD Bacillus subtilis (strain 168)
P94504 2.83e-37 133 32 3 228 3 yvrH Transcriptional regulatory protein YvrH Bacillus subtilis (strain 168)
P45606 3.84e-37 132 34 4 224 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Shigella dysenteriae
P0AFJ5 4.01e-37 132 34 4 224 1 phoB Phosphate regulon transcriptional regulatory protein PhoB Escherichia coli (strain K12)
P0AFJ6 4.01e-37 132 34 4 224 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Escherichia coli O157:H7
P23620 6.22e-37 132 34 3 224 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
L7N689 8.05e-37 132 35 3 222 1 trcR Transcriptional regulatory protein TrcR Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q57QC3 8.38e-37 131 35 4 225 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella choleraesuis (strain SC-B67)
Q7A0U4 1.27e-36 131 33 3 227 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MW2)
Q9L524 1.27e-36 131 33 3 227 2 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus
Q6G972 1.27e-36 131 33 3 227 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MSSA476)
Q6GGK6 1.27e-36 131 33 3 227 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MRSA252)
Q7A5H6 1.27e-36 131 33 3 227 1 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain N315)
Q7A2R6 1.27e-36 131 33 3 227 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HFT0 1.27e-36 131 33 3 227 2 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain COL)
Q2FY79 1.27e-36 131 33 3 227 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain NCTC 8325 / PS 47)
P42244 1.3e-36 131 32 1 223 3 ycbL Uncharacterized transcriptional regulatory protein YcbL Bacillus subtilis (strain 168)
Q9HV32 1.51e-36 130 39 7 224 1 pmrA Response regulator protein PmrA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A0QTK2 6.29e-36 129 33 1 219 1 mtrA DNA-binding response regulator MtrA Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
P45607 7.83e-36 129 33 4 224 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Shigella flexneri
Q9ZEP4 7.93e-36 129 35 2 231 1 cseB Transcriptional regulatory protein CseB Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q31S42 8.69e-36 129 34 2 224 1 rpaA DNA-binding dual master transcriptional regulator RpaA Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q06239 8.99e-36 129 31 2 225 3 vanR Regulatory protein VanR Enterococcus faecium
Q55890 1.04e-35 129 35 2 227 1 rpaA DNA-binding dual master transcriptional regulator RpaA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q50136 1.76e-35 128 38 3 189 3 prrA Transcriptional regulatory protein PrrA Mycobacterium leprae (strain TN)
P45605 3.87e-35 127 32 3 223 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Klebsiella pneumoniae
Q5HPC3 4.25e-35 127 35 5 223 3 arlR Response regulator ArlR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P30843 4.65e-35 127 34 5 227 1 basR Transcriptional regulatory protein BasR Escherichia coli (strain K12)
Q49XM7 5.64e-35 127 33 3 221 3 arlR Response regulator ArlR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
P9WGM1 6.8e-35 127 37 3 196 1 prrA Transcriptional regulatory protein PrrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM0 6.8e-35 127 37 3 196 3 prrA Transcriptional regulatory protein PrrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A5Z7 6.8e-35 127 37 3 196 3 prrA Transcriptional regulatory protein PrrA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P0DMK7 6.83e-35 127 36 3 228 3 irlR Transcriptional activator protein IrlR Burkholderia pseudomallei (strain K96243)
I1WSZ4 6.83e-35 127 36 3 228 3 irlR Transcriptional activator protein IrlR Burkholderia pseudomallei (strain 1026b)
Q8CP82 1.15e-34 125 35 5 223 3 arlR Response regulator ArlR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q82EB1 4.37e-34 125 34 2 232 3 cseB Transcriptional regulatory protein CseB Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
P9WGM7 5.73e-34 124 32 1 219 1 mtrA DNA-binding response regulator MtrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM6 5.73e-34 124 32 1 219 3 mtrA DNA-binding response regulator MtrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A5Z5 5.73e-34 124 32 1 219 3 mtrA DNA-binding response regulator MtrA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q93CB8 6.79e-34 124 32 1 219 3 mtrA DNA-binding response regulator MtrA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
P45189 7.83e-34 124 32 5 226 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9KM23 1.01e-33 124 35 4 224 1 vxrB Transcriptional regulatory protein VxrB Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q52990 1.02e-33 124 34 5 228 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Rhizobium meliloti (strain 1021)
Q04942 1.12e-33 123 34 1 223 1 afsQ1 Transcriptional regulatory protein AfsQ1 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q9HUI2 2.12e-33 123 35 5 234 3 aruR Transcriptional regulatory protein AruR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9CCJ2 2.48e-33 122 32 1 219 3 mtrA DNA-binding response regulator MtrA Mycobacterium leprae (strain TN)
Q44006 6.5e-33 121 34 2 218 2 czcR Transcriptional activator protein CzcR Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q47456 2.14e-32 120 35 5 224 3 pcoR Transcriptional regulatory protein PcoR Escherichia coli
P0ACZ8 4.68e-32 119 33 3 221 1 cusR Transcriptional regulatory protein CusR Escherichia coli (strain K12)
P0ACZ9 4.68e-32 119 33 3 221 3 cusR Transcriptional regulatory protein CusR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AD00 4.68e-32 119 33 3 221 3 cusR Transcriptional regulatory protein CusR Escherichia coli O157:H7
Q70FH0 7.68e-32 119 35 5 223 3 pmrA Transcriptional regulatory protein PmrA Pectobacterium parmentieri
Q8CQ37 7.9e-32 119 31 3 230 3 graR Response regulator protein GraR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HR81 7.9e-32 119 31 3 230 3 graR Response regulator protein GraR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P08368 1.7e-31 118 35 3 223 1 creB Transcriptional regulatory protein CreB Escherichia coli (strain K12)
Q8FZ93 7.01e-31 116 31 2 219 1 ctrA Cell cycle response regulator CtrA Brucella suis biovar 1 (strain 1330)
B0CI76 7.01e-31 116 31 2 219 3 ctrA Cell cycle response regulator CtrA Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VRW9 7.01e-31 116 31 2 219 1 ctrA Cell cycle response regulator CtrA Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q7CNV1 7.01e-31 116 31 2 219 1 ctrA Cell cycle response regulator CtrA Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
A9M708 7.01e-31 116 31 2 219 3 ctrA Cell cycle response regulator CtrA Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q9ZHS1 7.01e-31 116 31 2 219 1 ctrA Cell cycle response regulator CtrA Brucella abortus biovar 1 (strain 9-941)
Q2YQA4 7.01e-31 116 31 2 219 1 ctrA Cell cycle response regulator CtrA Brucella abortus (strain 2308)
B2S753 7.01e-31 116 31 2 219 3 ctrA Cell cycle response regulator CtrA Brucella abortus (strain S19)
O69730 7.6e-31 116 32 4 223 1 tcrX Probable transcriptional regulatory protein TcrX Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q7D9K0 8.65e-31 117 36 4 225 3 tcrA Transcriptional regulatory protein TcrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O07776 8.65e-31 117 36 4 225 1 tcrA Transcriptional regulatory protein TcrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P36556 9.34e-31 115 32 5 228 1 basR Transcriptional regulatory protein BasR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
O24973 1.4e-30 115 35 2 226 1 arsR Transcriptional regulatory protein ArsR Helicobacter pylori (strain ATCC 700392 / 26695)
A6WZ81 2.1e-30 115 31 2 219 3 ctrA Cell cycle response regulator CtrA Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
P44918 3.11e-30 115 31 2 227 3 arcA Aerobic respiration control protein ArcA homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P94413 3.14e-30 114 32 7 230 3 yclJ Uncharacterized transcriptional regulatory protein YclJ Bacillus subtilis (strain 168)
Q02540 4.09e-30 114 35 4 184 1 copR Transcriptional activator protein CopR Pseudomonas syringae pv. tomato
A0A4P7TS68 4.46e-30 114 32 6 231 1 ompR DNA-binding dual transcriptional regulator OmpR Shigella flexneri serotype 5a (strain M90T)
P0AA21 4.46e-30 114 32 6 231 3 ompR DNA-binding dual transcriptional regulator OmpR Shigella flexneri
P0AA19 4.46e-30 114 32 6 231 3 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A0A0H3NGY1 4.46e-30 114 32 6 231 3 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhimurium (strain SL1344)
P0AA20 4.46e-30 114 32 6 231 1 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhi
P0AA16 4.46e-30 114 32 6 231 1 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli (strain K12)
P0AA17 4.46e-30 114 32 6 231 3 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AA18 4.46e-30 114 32 6 231 3 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli O157:H7
P0A9Q4 4.49e-30 114 33 3 228 3 arcA Aerobic respiration control protein ArcA Shigella flexneri
P0A9Q1 4.49e-30 114 33 3 228 1 arcA Aerobic respiration control protein ArcA Escherichia coli (strain K12)
P0A9Q2 4.49e-30 114 33 3 228 3 arcA Aerobic respiration control protein ArcA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9Q3 4.49e-30 114 33 3 228 3 arcA Aerobic respiration control protein ArcA Escherichia coli O157:H7
Q44929 4.54e-30 114 30 3 232 3 gtcR Response regulator GtcR Aneurinibacillus migulanus
P76340 4.55e-30 114 31 4 225 1 hprR Transcriptional regulatory protein HprR Escherichia coli (strain K12)
Q9I4F9 4.98e-30 114 34 4 206 1 phoP Two-component response regulator PhoP Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A8Z181 6.02e-30 114 28 2 221 3 graR Response regulator protein GraR Staphylococcus aureus (strain USA300 / TCH1516)
A6QEW8 6.02e-30 114 28 2 221 3 graR Response regulator protein GraR Staphylococcus aureus (strain Newman)
Q5HI09 6.02e-30 114 28 2 221 1 graR Response regulator protein GraR Staphylococcus aureus (strain COL)
Q2G0E0 6.02e-30 114 28 2 221 1 graR Response regulator protein GraR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FIY0 6.02e-30 114 28 2 221 3 graR Response regulator protein GraR Staphylococcus aureus (strain USA300)
Q932F1 6.69e-30 114 28 2 221 1 graR Response regulator protein GraR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q01473 6.98e-30 119 34 5 228 3 rcaC Protein RcaC Microchaete diplosiphon
Q01473 3.07e-08 57 30 2 120 3 rcaC Protein RcaC Microchaete diplosiphon
P52076 7.33e-30 113 34 5 222 2 qseB Transcriptional regulatory protein QseB Escherichia coli (strain K12)
Q7A1L2 8.02e-30 113 28 2 221 3 graR Response regulator protein GraR Staphylococcus aureus (strain MW2)
Q6GBH1 8.02e-30 113 28 2 221 3 graR Response regulator protein GraR Staphylococcus aureus (strain MSSA476)
Q99VW2 8.02e-30 113 28 2 221 3 graR Response regulator protein GraR Staphylococcus aureus (strain N315)
A5IQL2 8.02e-30 113 28 2 221 3 graR Response regulator protein GraR Staphylococcus aureus (strain JH9)
A6TZD6 8.02e-30 113 28 2 221 3 graR Response regulator protein GraR Staphylococcus aureus (strain JH1)
A7WZC3 8.02e-30 113 28 2 221 3 graR Response regulator protein GraR Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q8XBS3 1.16e-29 113 34 5 222 2 qseB Transcriptional regulatory protein QseB Escherichia coli O157:H7
Q4L481 1.38e-29 113 30 3 230 3 graR Response regulator protein GraR Staphylococcus haemolyticus (strain JCSC1435)
Q2YSS2 1.38e-29 113 28 2 219 3 graR Response regulator protein GraR Staphylococcus aureus (strain bovine RF122 / ET3-1)
P69228 1.47e-29 113 33 2 221 1 baeR Transcriptional regulatory protein BaeR Escherichia coli (strain K12)
P69229 1.47e-29 113 33 2 221 1 baeR Transcriptional regulatory protein BaeR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q6GJ11 1.8e-29 112 28 2 221 3 graR Response regulator protein GraR Staphylococcus aureus (strain MRSA252)
B8H358 2.04e-29 112 30 2 219 3 ctrA Cell cycle transcriptional regulator CtrA Caulobacter vibrioides (strain NA1000 / CB15N)
P0CAW8 2.04e-29 112 30 2 219 3 ctrA Cell cycle transcriptional regulator CtrA Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q9I0I1 4.21e-29 111 36 3 186 1 carR Response regulator protein CarR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8CQ17 4.86e-29 111 30 3 226 1 saeR Response regulator SaeR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HR28 4.86e-29 111 30 3 226 3 saeR Response regulator SaeR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P0A4I0 5.23e-29 111 31 5 222 3 dltR Transcriptional regulatory protein DltR Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P0A4H9 5.23e-29 111 31 5 222 3 dltR Transcriptional regulatory protein DltR Streptococcus agalactiae serotype III (strain NEM316)
Q7A1J1 1.5e-28 110 30 4 226 3 saeR Response regulator SaeR Staphylococcus aureus (strain MW2)
Q6GBC4 1.5e-28 110 30 4 226 3 saeR Response regulator SaeR Staphylococcus aureus (strain MSSA476)
Q6GIT6 1.5e-28 110 30 4 226 3 saeR Response regulator SaeR Staphylococcus aureus (strain MRSA252)
Q7A6V3 1.5e-28 110 30 4 226 1 saeR Response regulator SaeR Staphylococcus aureus (strain N315)
Q99VR7 1.5e-28 110 30 4 226 3 saeR Response regulator SaeR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q840P8 1.5e-28 110 30 4 226 1 saeR Response regulator SaeR Staphylococcus aureus (strain Newman)
Q5HHW4 1.5e-28 110 30 4 226 1 saeR Response regulator SaeR Staphylococcus aureus (strain COL)
Q2YSM5 1.5e-28 110 30 4 226 3 saeR Response regulator SaeR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2G2G2 1.5e-28 110 30 4 226 1 saeR Response regulator SaeR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FIT4 1.5e-28 110 30 4 226 3 saeR Response regulator SaeR Staphylococcus aureus (strain USA300)
P0A4H8 1.68e-28 110 29 5 224 3 ciaR Transcriptional regulatory protein CiaR Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A4H7 1.68e-28 110 29 5 224 3 ciaR Transcriptional regulatory protein CiaR Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q49VK3 5.6e-28 108 28 2 219 3 graR Response regulator protein GraR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
P42421 6.03e-28 108 31 1 206 3 yxdJ Transcriptional regulatory protein YxdJ Bacillus subtilis (strain 168)
G3XCY6 1.07e-27 108 31 3 224 1 gltR Transcriptional regulatory protein GltR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P31079 1.46e-27 108 31 3 224 3 petR Protein PetR Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
P0A4I2 1.83e-27 107 33 3 221 3 cutR Transcriptional regulatory protein CutR Streptomyces lividans
P0A4I1 1.83e-27 107 33 3 221 3 cutR Transcriptional regulatory protein CutR Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
O06978 3.52e-27 107 30 2 228 3 yvcP Uncharacterized transcriptional regulatory protein YvcP Bacillus subtilis (strain 168)
Q9AE24 4.88e-27 106 28 3 224 3 rprY Transcriptional regulatory protein RprY Bacteroides fragilis (strain YCH46)
Q9ZHD3 2.51e-26 104 33 5 223 3 silR Probable transcriptional regulatory protein SilR Salmonella typhimurium
Q9K621 4.28e-26 103 27 2 222 3 bceR Sensory transduction protein BceR Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q5HLN2 1.7e-25 102 28 2 222 3 hssR Heme response regulator HssR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8CN92 1.71e-25 102 28 2 222 3 hssR Heme response regulator HssR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
P0AE90 2.53e-25 102 31 4 235 3 cpxR Transcriptional regulatory protein CpxR Shigella flexneri
P0AE88 2.53e-25 102 31 4 235 1 cpxR Transcriptional regulatory protein CpxR Escherichia coli (strain K12)
P0AE89 2.53e-25 102 31 4 235 3 cpxR Transcriptional regulatory protein CpxR Escherichia coli O157:H7
O34951 4.2e-25 101 29 3 223 3 bceR Sensory transduction protein BceR Bacillus subtilis (strain 168)
Q4L8L9 4.3e-25 101 28 2 225 3 hssR Heme response regulator HssR Staphylococcus haemolyticus (strain JCSC1435)
A0A0H3GGB5 4.57e-25 101 29 3 235 2 cpxR Transcriptional regulatory protein CpxR Klebsiella pneumoniae subsp. pneumoniae (strain HS11286)
P44895 4.69e-25 101 30 2 202 3 cpxR Transcriptional regulatory protein CpxR homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P66795 5.68e-25 100 32 5 222 3 qseB Transcriptional regulatory protein QseB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P66796 5.68e-25 100 32 5 222 3 qseB Transcriptional regulatory protein QseB Salmonella typhi
Q47744 7.73e-25 100 31 6 234 3 vanRB Regulatory protein VanRB Enterococcus faecalis (strain ATCC 700802 / V583)
P45337 8.24e-25 100 31 3 219 3 qseB Transcriptional regulatory protein QseB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q07597 9.34e-25 100 29 4 228 3 nisR Nisin biosynthesis regulatory protein NisR Lactococcus lactis subsp. lactis
Q8GP20 3.08e-24 99 29 3 221 1 rssB Swarming motility regulation protein RssB Serratia marcescens
P13359 5.85e-24 98 32 5 230 3 virG Regulatory protein VirG Rhizobium rhizogenes
P55701 6.48e-24 98 33 3 176 4 NGR_a00800 Probable transcriptional regulatory protein y4xI Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q8DN02 6.64e-24 98 29 3 223 1 rr06 Response regulator RR06 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
A0A0H2ZNF6 6.64e-24 98 29 3 223 1 rr06 Response regulator RR06 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q49ZT8 2.47e-23 96 27 3 223 3 hssR Heme response regulator HssR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
P0CL17 4.99e-23 95 34 4 175 2 tctD Transcriptional regulatory protein TctD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
E1WA34 4.99e-23 95 34 4 175 3 tctD Transcriptional regulatory protein TctD Salmonella typhimurium (strain SL1344)
P62722 6.45e-23 96 33 6 227 3 virG Regulatory protein VirG Agrobacterium tumefaciens (strain 15955)
Q07783 7.49e-23 95 28 1 240 3 chvI Transcriptional regulatory protein ChvI Rhizobium radiobacter
P58357 1.78e-22 94 29 7 231 3 torR TorCAD operon transcriptional regulatory protein TorR Escherichia coli O157:H7
Q04803 4.91e-22 95 31 0 221 3 pfeR Transcriptional activator protein PfeR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P07545 1.22e-21 92 33 6 227 3 virG Regulatory protein VirG Agrobacterium fabrum (strain C58 / ATCC 33970)
Q55933 2.43e-21 91 29 7 237 1 rppA Response regulator RppA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P38684 2.57e-21 91 28 7 232 1 torR TorCAD operon transcriptional regulatory protein TorR Escherichia coli (strain K12)
P50350 3e-21 91 29 2 236 3 chvI Transcriptional regulatory protein ChvI Rhizobium meliloti (strain 1021)
Q2YZ24 8.5e-21 90 24 1 204 3 hssR Heme response regulator HssR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q44444 8.66e-21 90 34 3 169 3 virG Regulatory protein VirG Rhizobium radiobacter
Q6GE73 9.54e-21 89 25 1 204 3 hssR Heme response regulator HssR Staphylococcus aureus (strain MRSA252)
Q7A039 2.95e-20 88 24 1 204 3 hssR Heme response regulator HssR Staphylococcus aureus (strain MW2)
A8Z552 2.95e-20 88 24 1 204 3 hssR Heme response regulator HssR Staphylococcus aureus (strain USA300 / TCH1516)
Q6G6V9 2.95e-20 88 24 1 204 3 hssR Heme response regulator HssR Staphylococcus aureus (strain MSSA476)
Q7A3X1 2.95e-20 88 24 1 204 3 hssR Heme response regulator HssR Staphylococcus aureus (strain N315)
Q99RR6 2.95e-20 88 24 1 204 3 hssR Heme response regulator HssR Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5IVE2 2.95e-20 88 24 1 204 3 hssR Heme response regulator HssR Staphylococcus aureus (strain JH9)
Q2FVQ9 2.95e-20 88 24 1 204 3 hssR Heme response regulator HssR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FED5 2.95e-20 88 24 1 204 3 hssR Heme response regulator HssR Staphylococcus aureus (strain USA300)
A6U488 2.95e-20 88 24 1 204 3 hssR Heme response regulator HssR Staphylococcus aureus (strain JH1)
A7X5Y5 2.95e-20 88 24 1 204 3 hssR Heme response regulator HssR Staphylococcus aureus (strain Mu3 / ATCC 700698)
P33112 4.22e-20 88 27 3 223 3 spaR Transcriptional regulatory protein SpaR Bacillus subtilis
O32192 4.42e-20 88 31 8 234 1 cssR Transcriptional regulatory protein CssR Bacillus subtilis (strain 168)
A6QJK3 6.79e-20 87 24 1 204 1 hssR Heme response regulator HssR Staphylococcus aureus (strain Newman)
Q5HDJ4 6.79e-20 87 24 1 204 3 hssR Heme response regulator HssR Staphylococcus aureus (strain COL)
P39901 9.04e-20 82 67 1 53 5 ybfI Putative uncharacterized protein YbfI Escherichia coli (strain K12)
P50351 2e-19 86 27 1 237 3 chvI Transcriptional regulatory protein ChvI Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P52108 1.91e-15 75 26 3 233 1 rstA Transcriptional regulatory protein RstA Escherichia coli (strain K12)
O25918 2.69e-15 75 25 7 224 3 crdR Transcriptional regulatory protein CrdR Helicobacter pylori (strain ATCC 700392 / 26695)
O31432 9.92e-15 73 29 6 191 3 ybdJ Uncharacterized transcriptional regulatory protein YbdJ Bacillus subtilis (strain 168)
P72781 6.72e-14 71 36 3 126 1 rre1 Response regulator Rre1 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q8KIY1 3.05e-13 71 37 2 116 1 tmoS Sensor histidine kinase TmoS Pseudomonas mendocina
T2KMF4 5.29e-13 71 33 2 117 3 BN863_21930 Histidine kinase P4 Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1)
P40138 1.41e-12 69 31 3 154 1 cyaB Adenylate cyclase 2 Stigmatella aurantiaca
P0AFB8 2.18e-12 68 32 2 125 1 glnG DNA-binding transcriptional regulator NtrC Escherichia coli (strain K12)
P0AFB9 2.18e-12 68 32 2 125 3 glnG DNA-binding transcriptional regulator NtrC Escherichia coli O157:H7
Q54SP4 4.03e-12 68 36 2 116 2 dhkD Hybrid signal transduction histidine kinase D Dictyostelium discoideum
Q54SP4 9.22e-05 46 27 2 111 2 dhkD Hybrid signal transduction histidine kinase D Dictyostelium discoideum
P41789 4.15e-12 68 31 1 122 1 glnG DNA-binding transcriptional regulator NtrC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
E0X9C7 5.73e-12 68 36 2 116 1 todS Sensor histidine kinase TodS Pseudomonas putida (strain DOT-T1E)
A5W4E3 8.04e-12 67 36 2 116 1 todS Sensor histidine kinase TodS Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q06065 9.18e-12 67 34 1 107 1 atoC Regulatory protein AtoC Escherichia coli (strain K12)
P43501 1.04e-11 63 33 1 106 3 pilH Protein PilH Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P48359 1.89e-11 64 28 1 122 3 ycf29 Probable transcriptional regulator ycf29 Cyanophora paradoxa
Q10WZ6 2.03e-11 65 27 8 205 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Trichodesmium erythraeum (strain IMS101)
Q4UU85 3.02e-11 65 32 2 128 1 rpfG Cyclic di-GMP phosphodiesterase response regulator RpfG Xanthomonas campestris pv. campestris (strain 8004)
P46384 5.79e-11 61 30 1 115 1 pilG Protein PilG Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P03029 9.22e-11 64 30 2 126 1 ntrC DNA-binding transcriptional regulator NtrC Klebsiella pneumoniae
Q05943 1.16e-10 63 33 2 135 3 glnR Transcriptional regulatory protein GlnR Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P52942 1.43e-10 60 35 3 112 3 spo0F Sporulation initiation phosphotransferase F Bacillus thuringiensis subsp. kurstaki
Q9F8D7 2.15e-10 63 31 2 138 3 gacS Sensor histidine kinase GacS Pseudomonas protegens (strain DSM 19095 / LMG 27888 / CFBP 6595 / CHA0)
P51586 2.94e-10 59 33 1 110 3 None Uncharacterized 14.6 kDa protein in sodA1 3'region Leptolyngbya boryana
P09432 4.38e-10 62 36 2 122 3 ntrC DNA-binding transcriptional regulator NtrC Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q00934 8.56e-10 61 35 3 127 1 pilR Response regulator protein PilR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q54YZ9 8.88e-10 61 31 1 114 3 dhkJ Hybrid signal transduction histidine kinase J Dictyostelium discoideum
B8GZM2 8.89e-10 61 32 1 117 1 pleD Response regulator PleD Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A5I5 8.89e-10 61 32 1 117 1 pleD Response regulator PleD Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q1D359 1.46e-09 60 36 2 104 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Myxococcus xanthus (strain DK1622)
B0R4K1 1.55e-09 57 33 1 101 1 cheY Chemotaxis protein CheY Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Q9K998 1.79e-09 59 31 3 116 3 dctR Probable C4-dicarboxylate response regulator DctR Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
P94514 1.9e-09 59 30 2 115 3 lytT Sensory transduction protein LytT Bacillus subtilis (strain 168)
P24072 2.22e-09 57 31 2 102 1 cheY Chemotaxis protein CheY Bacillus subtilis (strain 168)
Q9APD9 3.06e-09 59 29 2 135 3 zraR Transcriptional regulatory protein ZraR Klebsiella oxytoca
P28787 3.36e-09 59 29 4 128 3 ntrC DNA-binding transcriptional regulator NtrC Proteus hauseri
Q15RF6 3.43e-09 59 32 4 131 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
P96602 6.45e-09 57 33 3 127 3 dctR Probable C4-dicarboxylate response regulator DctR Bacillus subtilis (strain 168)
P0AE69 7.05e-09 55 29 2 121 3 cheY Chemotaxis protein CheY Shigella flexneri
P0AE67 7.05e-09 55 29 2 121 1 cheY Chemotaxis protein CheY Escherichia coli (strain K12)
P0AE68 7.05e-09 55 29 2 121 3 cheY Chemotaxis protein CheY Escherichia coli O157:H7
A1SMR4 7.49e-09 58 38 4 113 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Nocardioides sp. (strain ATCC BAA-499 / JS614)
P0C5S3 8.44e-09 57 31 1 111 3 actR Acid tolerance regulatory protein ActR Rhizobium meliloti (strain 1021)
P06628 8.79e-09 55 31 3 112 1 spo0F Sporulation initiation phosphotransferase F Bacillus subtilis (strain 168)
Q93P00 8.9e-09 55 29 2 118 3 cheY Chemotaxis protein CheY Yersinia enterocolitica
Q8FGP6 1.21e-08 55 29 2 121 3 cheY Chemotaxis protein CheY Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A6UEL7 1.44e-08 56 31 1 111 3 actR Acid tolerance regulatory protein ActR Sinorhizobium medicae (strain WSM419)
P0A2D5 1.49e-08 55 28 2 121 1 cheY Chemotaxis protein CheY Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2D6 1.49e-08 55 28 2 121 3 cheY Chemotaxis protein CheY Salmonella typhi
O83639 1.55e-08 57 31 5 122 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Treponema pallidum (strain Nichols)
Q9FAD7 1.57e-08 54 31 2 115 3 cheY Chemotaxis protein CheY Enterobacter cloacae
Q2ILG8 1.65e-08 57 37 2 103 3 cheB6 Protein-glutamate methylesterase/protein-glutamine glutaminase 6 Anaeromyxobacter dehalogenans (strain 2CP-C)
P9WGM3 1.88e-08 56 33 1 118 1 pdtaR Transcriptional regulatory protein PdtaR Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM2 1.88e-08 56 33 1 118 3 pdtaR Transcriptional regulatory protein PdtaR Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q8D0P1 2.12e-08 54 28 2 118 3 cheY Chemotaxis protein CheY Yersinia pestis
Q9KQD8 2.34e-08 57 35 3 106 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P24908 2.94e-08 55 33 2 109 1 PA0034 Putative transcriptional regulator Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
O82868 3.15e-08 55 31 1 111 3 regA Photosynthetic apparatus regulatory protein RegA Rhodovulum sulfidophilum
Q9KA55 3.25e-08 56 32 3 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q30RX5 3.62e-08 56 35 3 111 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
Q12YX1 3.68e-08 56 28 3 113 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M)
Q7MIQ5 3.79e-08 56 33 6 148 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Vibrio vulnificus (strain YJ016)
Q8DB67 3.86e-08 56 33 6 148 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Vibrio vulnificus (strain CMCP6)
Q24T61 4.31e-08 56 33 3 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Desulfitobacterium hafniense (strain Y51)
Q2SFK0 4.54e-08 56 34 2 103 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Hahella chejuensis (strain KCTC 2396)
P62646 6.66e-08 55 33 4 106 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q87MK5 7.14e-08 55 33 5 136 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q9WY30 9.34e-08 55 30 2 117 1 TM_0186 Cyclic di-GMP phosphodiesterase TM_0186 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
O25153 1.02e-07 55 25 2 106 1 cheAY Sensor histidine kinase CheAY Helicobacter pylori (strain ATCC 700392 / 26695)
O29221 1.12e-07 55 29 3 121 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q04849 1.26e-07 55 33 2 108 3 ntrX Nitrogen assimilation regulatory protein NtrX Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q3IRR4 1.28e-07 54 33 2 104 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Natronomonas pharaonis (strain ATCC 35678 / DSM 2160 / CIP 103997 / JCM 8858 / NBRC 14720 / NCIMB 2260 / Gabara)
P96686 1.37e-07 53 29 2 106 3 ydfI Transcriptional regulatory protein YdfI Bacillus subtilis (strain 168)
P62638 1.45e-07 54 28 8 206 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q5E3S1 1.46e-07 54 31 4 130 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q88EW5 1.47e-07 54 34 2 106 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase of group 1 operon Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
O52262 1.68e-07 54 34 2 106 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Pseudomonas putida
Q2RZD2 1.88e-07 54 33 3 114 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Salinibacter ruber (strain DSM 13855 / M31)
Q4KG36 2.01e-07 54 34 2 106 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q3IDZ3 2.14e-07 54 34 3 106 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Pseudoalteromonas translucida (strain TAC 125)
P52940 2.41e-07 53 33 2 117 3 spo0A Stage 0 sporulation protein A homolog Clostridium pasteurianum
Q3KFZ6 2.83e-07 53 34 3 106 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Pseudomonas fluorescens (strain Pf0-1)
P52936 2.91e-07 53 27 6 197 3 spo0A Stage 0 sporulation protein A homolog Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
P0A4H5 3.1e-07 50 30 2 105 3 cheY Chemotaxis protein CheY Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
P0A4H6 3.1e-07 50 30 2 105 3 cheY Chemotaxis protein CheY Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q7CQM5 3.48e-07 52 35 2 82 1 ssrB Response regulator SsrB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P10577 3.59e-07 53 32 1 107 1 ntrC DNA-binding transcriptional regulator NtrC Rhizobium meliloti (strain 1021)
Q39T95 3.73e-07 53 33 1 103 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q2LR65 3.87e-07 53 35 3 107 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Syntrophus aciditrophicus (strain SB)
Q0A9Z5 4.5e-07 53 31 3 108 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q39QJ2 4.6e-07 53 32 4 125 3 cheB5 Protein-glutamate methylesterase/protein-glutamine glutaminase 5 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q8DVB7 4.63e-07 52 27 2 115 3 lytR Sensory transduction protein LytR Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q1IQS9 4.69e-07 53 33 3 105 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Koribacter versatilis (strain Ellin345)
P48027 4.7e-07 53 31 1 107 3 gacS Sensor protein GacS Pseudomonas syringae pv. syringae
O33558 4.83e-07 53 32 3 110 1 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase of group 3 operon Cereibacter sphaeroides
Q1XDE4 5.16e-07 52 27 1 118 3 ycf29 Probable transcriptional regulator ycf29 Neopyropia yezoensis
Q56312 5.78e-07 50 30 2 102 1 cheY Chemotaxis protein CheY Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
P58253 5.8e-07 52 27 3 144 3 spo0A Stage 0 sporulation protein A homolog Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q8X613 5.81e-07 52 30 1 112 3 zraR Transcriptional regulatory protein ZraR Escherichia coli O157:H7
Q82Z76 5.97e-07 52 31 2 102 4 lytT Sensory transduction protein LytT Enterococcus faecalis (strain ATCC 700802 / V583)
Q3J653 7.14e-07 52 32 3 110 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q9ZM64 7.49e-07 50 24 3 120 3 cheY1 Chemotaxis protein CheY1 Helicobacter pylori (strain J99 / ATCC 700824)
P71403 7.64e-07 50 24 3 120 1 cheY1 Chemotaxis protein CheY1 Helicobacter pylori (strain ATCC 700392 / 26695)
Q53228 7.74e-07 51 28 1 107 1 regA Photosynthetic apparatus regulatory protein RegA Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q81JL3 7.79e-07 52 31 2 105 3 lytT Sensory transduction protein LytT Bacillus anthracis
Q5JF95 7.79e-07 52 30 2 114 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q8EEQ0 8.41e-07 52 34 2 106 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q3J1W3 8.71e-07 52 34 4 118 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q8RAZ3 9.67e-07 52 31 3 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
O07528 1.01e-06 51 31 3 125 3 yhcZ Uncharacterized transcriptional regulatory protein YhcZ Bacillus subtilis (strain 168)
Q4ZQV7 1.01e-06 52 33 2 106 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Pseudomonas syringae pv. syringae (strain B728a)
Q7NZB3 1.03e-06 52 33 4 109 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
P0DMI2 1.06e-06 52 31 2 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
B0R4K0 1.06e-06 52 31 2 105 1 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Q0AWZ8 1.08e-06 52 33 4 109 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
Q884V3 1.1e-06 52 33 2 106 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
P0AEC5 1.1e-06 52 30 4 123 1 barA Signal transduction histidine-protein kinase BarA Escherichia coli (strain K12)
P0AEC6 1.1e-06 52 30 4 123 1 barA Signal transduction histidine-protein kinase BarA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEC7 1.1e-06 52 30 4 123 3 barA Signal transduction histidine-protein kinase BarA Escherichia coli O157:H7
Q8KLS5 1.14e-06 52 34 4 118 1 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase of group 2 operon Cereibacter sphaeroides
Q48GG6 1.15e-06 52 33 2 106 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q3ADA6 1.26e-06 51 33 3 105 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
O49397 1.38e-06 52 32 1 108 1 ARR10 Two-component response regulator ARR10 Arabidopsis thaliana
O87125 1.39e-06 51 33 3 106 1 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q55169 1.54e-06 49 30 4 118 1 rcp1 Response regulator Rcp1 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P59342 1.6e-06 52 30 4 123 3 barA Signal transduction histidine-protein kinase BarA Shigella flexneri
Q88AQ2 1.64e-06 51 31 1 107 3 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q20XE6 1.67e-06 51 33 3 109 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Rhodopseudomonas palustris (strain BisB18)
Q5QZQ3 1.77e-06 51 31 3 106 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q75KW7 1.95e-06 48 34 4 125 3 RR41 Two-component response regulator ORR41 Oryza sativa subsp. japonica
Q89SQ1 2.04e-06 51 32 4 109 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase of group 3 operon Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q88RJ6 2.22e-06 51 31 1 107 3 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q9KL96 2.41e-06 50 34 2 94 3 VC_A0850 Uncharacterized response regulatory protein VC_A0850 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q13SY2 2.52e-06 50 32 4 107 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Paraburkholderia xenovorans (strain LB400)
P14375 2.54e-06 51 29 1 112 1 zraR Transcriptional regulatory protein ZraR Escherichia coli (strain K12)
Q814J1 2.56e-06 50 30 2 105 4 lytT Sensory transduction protein LytT Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q2W2W9 2.56e-06 50 33 2 103 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
P42508 2.57e-06 49 28 1 107 3 regA Photosynthetic apparatus regulatory protein RegA Rhodobacter capsulatus
A6X580 2.69e-06 48 27 1 106 3 divK Polar-differentiation response regulator DivK Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q2FQU2 2.89e-06 50 25 6 199 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1)
Q5V0B3 3.22e-06 50 38 2 75 1 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
Q4L8V4 3.27e-06 50 29 4 129 3 lytR Sensory transduction protein LytR Staphylococcus haemolyticus (strain JCSC1435)
Q8TLG9 3.41e-06 50 29 2 127 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q6LTM2 3.69e-06 50 31 5 137 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Photobacterium profundum (strain SS9)
P39048 3.82e-06 50 23 2 118 2 patA Protein PatA Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q820K0 3.87e-06 50 30 4 107 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q0HWY6 4.08e-06 50 31 4 130 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Shewanella sp. (strain MR-7)
Q7A0I0 4.24e-06 49 30 3 119 3 vraR Response regulator protein VraR Staphylococcus aureus (strain MW2)
Q6G850 4.24e-06 49 30 3 119 3 vraR Response regulator protein VraR Staphylococcus aureus (strain MSSA476)
Q6GFH3 4.24e-06 49 30 3 119 3 vraR Response regulator protein VraR Staphylococcus aureus (strain MRSA252)
Q7A4R9 4.24e-06 49 30 3 119 1 vraR Response regulator protein VraR Staphylococcus aureus (strain N315)
Q7A2Q1 4.24e-06 49 30 3 119 1 vraR Response regulator protein VraR Staphylococcus aureus (strain Mu50 / ATCC 700699)
P0C0Z1 4.24e-06 49 30 3 119 3 vraR Response regulator protein VraR Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q7N5T1 4.31e-06 50 30 4 107 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q9I6V9 4.38e-06 50 31 4 107 1 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9KU36 4.39e-06 49 28 3 125 3 VC_0693 Uncharacterized response regulatory protein VC_0693 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q0HKN5 4.47e-06 50 31 4 130 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Shewanella sp. (strain MR-4)
A1W0A5 4.94e-06 47 26 5 118 3 cheY Chemotaxis protein CheY homolog Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
P0C635 4.94e-06 47 26 5 118 3 cheY Chemotaxis protein CheY homolog Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A8FMH1 4.94e-06 47 26 5 118 3 cheY Chemotaxis protein CheY homolog Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
Q3SIG0 4.96e-06 50 31 3 107 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Thiobacillus denitrificans (strain ATCC 25259)
Q2T8Y6 4.99e-06 50 32 4 109 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q04848 5.02e-06 50 29 1 107 3 ntrC DNA-binding transcriptional regulator NtrC Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
P54662 5.23e-06 49 28 3 119 3 degU Transcriptional regulatory protein DegU Brevibacillus brevis
Q485K0 5.53e-06 50 35 3 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q1RJS1 5.97e-06 50 31 3 122 3 RBE_0312 Putative response regulator NtrX-like Rickettsia bellii (strain RML369-C)
P9WMF9 6e-06 48 27 5 154 1 devR DNA-binding transcriptional activator DevR/DosR Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WMF8 6e-06 48 27 5 154 2 devR DNA-binding transcriptional activator DevR/DosR Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P62647 6.46e-06 49 28 3 114 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
P62598 6.54e-06 50 28 2 128 2 ARR12 Two-component response regulator ARR12 Arabidopsis thaliana
P62640 6.83e-06 49 32 3 106 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q8E217 6.84e-06 49 27 2 106 3 lytR Sensory transduction protein LytR Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E7H3 6.84e-06 49 27 2 106 3 lytR Sensory transduction protein LytR Streptococcus agalactiae serotype III (strain NEM316)
P0AEV3 8.05e-06 49 32 1 100 3 rssB Regulator of RpoS Shigella flexneri
P0AEV1 8.05e-06 49 32 1 100 1 rssB Regulator of RpoS Escherichia coli (strain K12)
P0AEV2 8.05e-06 49 32 1 100 3 rssB Regulator of RpoS Escherichia coli O157:H7
Q12PJ3 8.58e-06 49 32 4 130 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
O87717 9.73e-06 49 28 5 129 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q5L0L0 1.03e-05 48 34 3 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Geobacillus kaustophilus (strain HTA426)
Q9KQD5 1.04e-05 47 26 3 123 1 VC_2065 Chemotaxis protein CheY-3 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A0A0H3AMJ9 1.04e-05 47 26 3 123 1 cheY-3 Chemotaxis protein CheY-3 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
P23747 1.09e-05 49 30 3 137 1 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q4UL27 1.15e-05 49 30 4 120 3 RF_0895 Putative response regulator NtrX-like Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
O05251 1.22e-05 48 31 3 122 3 malR Transcriptional regulatory protein MalR Bacillus subtilis (strain 168)
P25852 1.22e-05 48 28 1 112 1 zraR Transcriptional regulatory protein ZraR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q9HU19 1.22e-05 48 31 3 102 3 dctD C4-dicarboxylate transport transcriptional regulatory protein DctD Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8D4X6 1.23e-05 48 31 4 107 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Vibrio vulnificus (strain CMCP6)
Q8Z333 1.33e-05 48 28 1 112 3 zraR Transcriptional regulatory protein ZraR Salmonella typhi
P39486 1.33e-05 48 29 3 114 3 dctR Probable C4-dicarboxylate response regulator DctR Priestia megaterium
Q9HV27 1.37e-05 48 35 1 73 1 PA4781 Cyclic di-GMP phosphodiesterase PA4781 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P62645 1.45e-05 48 33 3 107 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase of group 3 operon Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q3A5A8 1.64e-05 48 30 4 109 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
P45671 1.68e-05 48 29 4 110 3 ntrC DNA-binding transcriptional regulator NtrC Azospirillum brasilense
P23221 1.76e-05 47 24 6 161 3 fixJ Transcriptional regulatory protein FixJ Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q9ZCY9 1.77e-05 48 30 4 120 3 RP562 Putative response regulator NtrX-like Rickettsia prowazekii (strain Madrid E)
O32197 1.83e-05 47 26 6 173 2 liaR Transcriptional regulatory protein LiaR Bacillus subtilis (strain 168)
Q87S86 1.87e-05 47 31 3 119 3 VP0538 Uncharacterized response regulatory protein VP0538 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q8F3H4 2.01e-05 48 30 3 113 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
P62643 2.01e-05 48 30 3 113 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q3ADG9 2.06e-05 48 33 3 119 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q2YV67 2.16e-05 47 25 3 127 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain bovine RF122 / ET3-1)
P60610 2.18e-05 47 25 3 127 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain N315)
P60609 2.18e-05 47 25 3 127 1 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HJB5 2.18e-05 47 25 3 127 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain COL)
P60611 2.18e-05 47 25 3 127 1 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FK09 2.18e-05 47 25 3 127 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain USA300)
Q2SBX9 2.26e-05 48 33 2 106 3 cheB4 Protein-glutamate methylesterase/protein-glutamine glutaminase 4 Hahella chejuensis (strain KCTC 2396)
Q8NYH3 2.27e-05 47 25 3 127 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain MW2)
Q6GCL1 2.27e-05 47 25 3 127 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain MSSA476)
Q6GK51 2.27e-05 47 25 3 127 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain MRSA252)
P13800 2.28e-05 47 28 6 125 1 degU Transcriptional regulatory protein DegU Bacillus subtilis (strain 168)
Q2KCH7 2.28e-05 46 28 2 118 3 cheY Probable chemotaxis protein CheY Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
P10576 2.32e-05 48 28 1 107 3 ntrC DNA-binding transcriptional regulator NtrC Bradyrhizobium sp. (strain RP501 Parasponia)
Q8ECD7 2.37e-05 48 30 4 130 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q7NSI8 2.38e-05 48 31 4 107 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q888V8 2.42e-05 48 31 4 109 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q1GZZ0 2.43e-05 48 30 4 107 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q31HL9 2.53e-05 47 29 3 111 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q8FW53 2.59e-05 45 26 1 106 3 divK Polar-differentiation response regulator DivK Brucella suis biovar 1 (strain 1330)
A9WYT1 2.59e-05 45 26 1 106 3 divK Polar-differentiation response regulator DivK Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VUU3 2.59e-05 45 26 1 106 3 divK Polar-differentiation response regulator DivK Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q8YC73 2.59e-05 45 26 1 106 3 divK Polar-differentiation response regulator DivK Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
A9MBQ2 2.59e-05 45 26 1 106 3 divK Polar-differentiation response regulator DivK Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q7BBW0 2.59e-05 45 26 1 106 1 divK Polar-differentiation response regulator DivK Brucella abortus biovar 1 (strain 9-941)
Q2YKN1 2.59e-05 45 26 1 106 3 divK Polar-differentiation response regulator DivK Brucella abortus (strain 2308)
B2SB45 2.59e-05 45 26 1 106 3 divK Polar-differentiation response regulator DivK Brucella abortus (strain S19)
Q56128 2.64e-05 48 27 1 118 3 rcsC Sensor histidine kinase RcsC Salmonella typhi
Q8EDD7 2.69e-05 47 32 3 115 3 SO_2823 Uncharacterized response regulatory protein SO_2823 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q68WH4 2.73e-05 48 29 4 120 3 RT0550 Putative response regulator NtrX-like Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q2LSL3 2.92e-05 47 26 4 132 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Syntrophus aciditrophicus (strain SB)
Q7MBQ5 2.96e-05 47 30 4 107 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Vibrio vulnificus (strain YJ016)
Q1MLG8 3.11e-05 47 25 8 221 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q1BRL2 3.18e-05 47 31 4 107 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Burkholderia orbicola (strain AU 1054)
Q8EQW0 3.38e-05 47 28 2 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
P52938 3.52e-05 47 28 5 146 3 spo0A Stage 0 sporulation protein A homolog Clostridioides difficile
P45365 3.76e-05 47 28 1 117 3 None Uncharacterized 76.5 kDa protein in phbC 3'region Thiocystis violacea
P58662 4.18e-05 47 27 1 118 3 rcsC Sensor histidine kinase RcsC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS11480
Feature type CDS
Gene kdpE
Product two-component system response regulator KdpE
Location 441007 - 441690 (strand: 1)
Length 684 (nucleotides) / 227 (amino acids)

Contig

Accession term accessions NZ_VXKB01000002 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 573139 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_760
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00072 Response regulator receiver domain
PF00486 Transcriptional regulatory protein, C terminal

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0745 Signal transduction mechanisms (T)
Transcription (K)		 TK DNA-binding response regulator, OmpR family, contains REC and winged-helix (wHTH) domain

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07667 two-component system, OmpR family, KDP operon response regulator KdpE Two-component system
Quorum sensing		 -

Protein Sequence

MITVLIVEDEKGIRRLLRTALEGDSLRVFDAENLARGLVEAATRKPDLVILDLGLPDGDGIEFVQQFRQWSSVPVLVLSARDDEHDKIAALDAGADDYMTKPFSVGELQARLRVLMRRYQGSEKNDPVYEFGDIRVDIAGRQISKAGEEVHLTPIEFRLLTILINHSGKVLTQRFLLNEVWGPNSVEHAHYLRIYMGHLRQKLETDPARPQHFITETGIGYRFISAP

Flanking regions ( +/- flanking 50bp)

CGTTTACCCTATAAAGACCCACCAACTATTGATGAAGCCGATAATCCATTGTGATCACTGTTTTAATTGTTGAAGATGAAAAAGGTATCCGCCGTCTTCTGCGCACTGCGCTGGAAGGGGATTCCCTACGCGTTTTTGACGCTGAAAATCTGGCCCGCGGGCTGGTGGAAGCCGCGACCCGCAAACCGGATCTGGTGATCCTCGACCTGGGATTGCCTGACGGCGACGGTATTGAGTTTGTACAACAATTCCGCCAGTGGAGCTCAGTTCCGGTTCTGGTACTTTCTGCCCGTGACGATGAGCATGATAAGATAGCTGCCCTTGATGCCGGGGCGGATGACTACATGACAAAACCCTTTAGTGTCGGGGAGTTACAGGCACGTTTGCGTGTTCTTATGCGCCGTTACCAGGGCAGTGAAAAAAATGATCCGGTGTATGAATTCGGGGATATCCGCGTGGATATTGCCGGACGTCAAATCAGCAAAGCCGGGGAAGAAGTGCATCTTACTCCGATAGAATTCCGCCTGCTGACTATTCTTATCAACCACAGCGGCAAAGTATTAACCCAGCGTTTTCTGCTCAATGAAGTGTGGGGTCCTAATTCAGTTGAGCATGCGCATTATCTGCGTATTTATATGGGGCATTTGCGTCAGAAGCTGGAAACAGATCCTGCCCGTCCTCAGCATTTTATTACTGAAACCGGGATCGGCTACCGGTTTATATCTGCACCTTAAATACATTTATTTTTCTAATTCTTTTACCTCCCTCACTGTTATGACAAAAC