Homologs in group_838

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_03540 FBDBKF_03540 86.3 Morganella morganii S1 yhhL DUF1145 domain-containing protein
EHELCC_06995 EHELCC_06995 86.3 Morganella morganii S2 yhhL DUF1145 domain-containing protein
NLDBIP_07320 NLDBIP_07320 86.3 Morganella morganii S4 yhhL DUF1145 domain-containing protein
LHKJJB_06855 LHKJJB_06855 86.3 Morganella morganii S3 yhhL DUF1145 domain-containing protein
HKOGLL_04075 HKOGLL_04075 86.3 Morganella morganii S5 yhhL DUF1145 domain-containing protein
PMI_RS17930 PMI_RS17930 49.5 Proteus mirabilis HI4320 - DUF1145 family protein

Distribution of the homologs in the orthogroup group_838

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_838

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P37614 2.39e-27 98 62 1 77 4 yhhL Uncharacterized protein YhhL Escherichia coli (strain K12)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS11360
Feature type CDS
Gene -
Product DUF1145 family protein
Location 414081 - 414392 (strand: -1)
Length 312 (nucleotides) / 103 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000002
Length 573139 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_838
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF06611 Protein of unknown function (DUF1145)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3776 Function unknown (S) S Uncharacterized conserved protein YhhL, DUF1145 family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K08993 putative membrane protein - -

Protein Sequence

MFWINIGRLLMLSVWSFLIFSLVHPFPKPLNIFMHIATFFMVVMHGLLMAMFNAGQPKDKKLTAAGKLRVFLFGVFELLIMLRRQQAELKSPPAGDDDKHDQP

Flanking regions ( +/- flanking 50bp)

CTTTACCTGCGGCAGGCAACTGCTGAGCAGGCTAATTAACAGGAGTCCGTATGTTCTGGATTAATATCGGCCGGTTGCTGATGTTATCAGTGTGGAGTTTTTTGATTTTCAGCCTGGTTCATCCGTTCCCGAAACCACTGAATATCTTTATGCATATCGCCACTTTTTTTATGGTCGTGATGCACGGTTTGCTGATGGCGATGTTCAATGCCGGTCAGCCGAAAGATAAAAAACTGACCGCTGCCGGCAAACTCCGTGTCTTTCTGTTCGGTGTTTTTGAGCTGCTTATCATGCTGCGCCGCCAGCAGGCAGAACTGAAATCCCCGCCTGCGGGCGATGACGATAAACACGACCAGCCCTGATCAGCGCAGCGGCTCATAACGGATAAAACGGGTGCCCTGCATAAAAAGCG