Homologs in group_2811

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_09395 FBDBKF_09395 95.2 Morganella morganii S1 - HTH cro/C1-type domain-containing protein
EHELCC_10015 EHELCC_10015 95.2 Morganella morganii S2 - HTH cro/C1-type domain-containing protein
NLDBIP_10360 NLDBIP_10360 95.2 Morganella morganii S4 - HTH cro/C1-type domain-containing protein
LHKJJB_10995 LHKJJB_10995 95.2 Morganella morganii S3 - HTH cro/C1-type domain-containing protein
HKOGLL_14055 HKOGLL_14055 95.2 Morganella morganii S5 - HTH cro/C1-type domain-containing protein

Distribution of the homologs in the orthogroup group_2811

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2811

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0C5S2 6.12e-08 50 38 0 60 4 R00410 Uncharacterized HTH-type transcriptional regulator R00410 Rhizobium meliloti (strain 1021)
A6U5H5 6.12e-08 50 38 0 60 4 Smed_0045 Uncharacterized HTH-type transcriptional regulator Smed_0045 Sinorhizobium medicae (strain WSM419)
P16117 2.79e-07 47 37 1 66 1 CI Repressor protein CI (Fragment) Enterobacteria phage 434
P15017 3.64e-07 47 34 0 63 4 None Uncharacterized transcriptional regulator in ATPase CF(0) region Rhodospirillum rubrum
P96631 2.5e-05 43 34 1 67 1 immR HTH-type transcriptional regulator ImmR Bacillus subtilis (strain 168)
P06966 3.93e-05 43 34 1 79 4 dicA HTH-type transcriptional regulator DicA Escherichia coli (strain K12)
Q8TZX4 0.000377 41 31 0 60 3 PF1851 Putative HTH-type transcriptional regulatory protein PF1851 Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
O31943 0.000477 39 30 0 63 4 yonR SPbeta prophage-derived uncharacterized HTH-type transcriptional regulator YonR Bacillus subtilis (strain 168)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS10570
Feature type CDS
Gene -
Product helix-turn-helix transcriptional regulator
Location 246982 - 247296 (strand: 1)
Length 315 (nucleotides) / 104 (amino acids)

Contig

Accession term accessions NZ_VXKB01000002 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 573139 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2811
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF01381 Helix-turn-helix

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1396 Transcription (K) K Transcriptional regulator, contains XRE-family HTH domain

Protein Sequence

METSDFYAVLGHRIQSRRKELGIVTVKLAQKLNISQQQFNRYERGVSKISLHHLIELSDLLDVPVEWFLNGKSEASEHPHEPHIQMRSNQFRAETVLLNGKQFI

Flanking regions ( +/- flanking 50bp)

GTATTTTTACTTAATTTAATTCACGACTTATAGAGAAATAGGTAGATATTATGGAAACTTCCGACTTTTATGCAGTCTTAGGCCACAGAATTCAATCAAGACGTAAAGAACTCGGGATCGTTACAGTTAAATTAGCGCAAAAACTGAATATCAGTCAGCAGCAATTTAACCGTTATGAGCGCGGTGTTAGTAAAATCAGTCTTCATCATCTCATTGAATTATCTGATTTATTAGACGTACCAGTTGAATGGTTCCTCAACGGAAAATCTGAAGCATCAGAACATCCTCACGAGCCACATATTCAGATGCGTTCAAATCAGTTCAGAGCAGAGACCGTTTTACTGAACGGAAAACAGTTTATTTAAATTTTTGATGCTGTTACTGAATTCTTCAGTAACAGAAACAAAATATATAA