Homologs in group_2811

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_09395 FBDBKF_09395 100.0 Morganella morganii S1 - HTH cro/C1-type domain-containing protein
NLDBIP_10360 NLDBIP_10360 100.0 Morganella morganii S4 - HTH cro/C1-type domain-containing protein
LHKJJB_10995 LHKJJB_10995 100.0 Morganella morganii S3 - HTH cro/C1-type domain-containing protein
HKOGLL_14055 HKOGLL_14055 100.0 Morganella morganii S5 - HTH cro/C1-type domain-containing protein
F4V73_RS10570 F4V73_RS10570 95.2 Morganella psychrotolerans - helix-turn-helix transcriptional regulator

Distribution of the homologs in the orthogroup group_2811

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2811

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P15017 2.79e-07 48 34 0 63 4 None Uncharacterized transcriptional regulator in ATPase CF(0) region Rhodospirillum rubrum
P0C5S2 4.31e-07 48 36 0 60 4 R00410 Uncharacterized HTH-type transcriptional regulator R00410 Rhizobium meliloti (strain 1021)
A6U5H5 4.31e-07 48 36 0 60 4 Smed_0045 Uncharacterized HTH-type transcriptional regulator Smed_0045 Sinorhizobium medicae (strain WSM419)
P06966 2.67e-05 43 34 1 79 4 dicA HTH-type transcriptional regulator DicA Escherichia coli (strain K12)
P16117 3.77e-05 42 32 1 67 1 CI Repressor protein CI (Fragment) Enterobacteria phage 434
P96631 0.000693 39 32 1 67 1 immR HTH-type transcriptional regulator ImmR Bacillus subtilis (strain 168)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_10015
Feature type CDS
Gene -
Product HTH cro/C1-type domain-containing protein
Location 37964 - 38278 (strand: 1)
Length 315 (nucleotides) / 104 (amino acids)

Contig

Accession ZDB_219
Length 213167 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2811
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF01381 Helix-turn-helix

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1396 Transcription (K) K Transcriptional regulator, contains XRE-family HTH domain

Protein Sequence

METSDFYAVLGHRIQSRRKELGIVTVKLAQKLNISQQQFNRYERGVSKISLHHLIELSELLYAPVEWFLSGKAEASEHPHEPHIQMRSNQFRAETVLLNGKQFI

Flanking regions ( +/- flanking 50bp)

TAATTTTACTTAATTGAATTCACGATTTATAGAGAAAATAGGCAGACATTATGGAAACTTCCGACTTTTATGCAGTCTTAGGCCACAGAATCCAATCAAGACGTAAAGAACTCGGGATTGTTACGGTTAAATTAGCGCAAAAACTGAATATCAGTCAGCAGCAATTTAACCGTTACGAACGCGGTGTCAGTAAAATCAGTCTGCATCATCTTATTGAATTATCTGAATTATTATATGCGCCGGTCGAATGGTTCCTCAGTGGTAAAGCTGAAGCATCAGAACATCCGCATGAACCGCATATTCAGATGCGTTCAAATCAGTTCAGAGCAGAAACAGTATTACTGAACGGCAAACAATTTATTTAAATCAAGATATTTTTTCTGTTGTTATCAATTCTGATACGACAGGCATTATC