Homologs in group_1468

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_09420 FBDBKF_09420 96.8 Morganella morganii S1 ahpC alkyl hydroperoxide reductase subunit C
EHELCC_09990 EHELCC_09990 96.8 Morganella morganii S2 ahpC alkyl hydroperoxide reductase subunit C
NLDBIP_10335 NLDBIP_10335 96.8 Morganella morganii S4 ahpC alkyl hydroperoxide reductase subunit C
LHKJJB_11020 LHKJJB_11020 96.8 Morganella morganii S3 ahpC alkyl hydroperoxide reductase subunit C
HKOGLL_14080 HKOGLL_14080 96.8 Morganella morganii S5 ahpC alkyl hydroperoxide reductase subunit C
PMI_RS05850 PMI_RS05850 92.5 Proteus mirabilis HI4320 ahpC alkyl hydroperoxide reductase subunit C

Distribution of the homologs in the orthogroup group_1468

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1468

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0A251 2.23e-129 363 89 0 187 1 ahpC Alkyl hydroperoxide reductase C Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A252 2.23e-129 363 89 0 187 3 ahpC Alkyl hydroperoxide reductase C Salmonella typhi
P0AE11 3.14e-129 363 89 0 187 3 ahpC Alkyl hydroperoxide reductase C Shigella flexneri
P0AE08 3.14e-129 363 89 0 187 1 ahpC Alkyl hydroperoxide reductase C Escherichia coli (strain K12)
P0AE09 3.14e-129 363 89 0 187 3 ahpC Alkyl hydroperoxide reductase C Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AE10 3.14e-129 363 89 0 187 3 ahpC Alkyl hydroperoxide reductase C Escherichia coli O157:H7
P80239 7.08e-92 269 64 0 187 1 ahpC Alkyl hydroperoxide reductase C Bacillus subtilis (strain 168)
K0J4Q8 1.11e-90 266 64 1 188 1 ahpC Alkyl hydroperoxide reductase C Amphibacillus xylanus (strain ATCC 51415 / DSM 6626 / JCM 7361 / LMG 17667 / NBRC 15112 / Ep01)
P0A0B6 3.1e-89 262 64 1 189 3 ahpC Alkyl hydroperoxide reductase C Staphylococcus aureus (strain MW2)
Q6GC91 3.1e-89 262 64 1 189 3 ahpC Alkyl hydroperoxide reductase C Staphylococcus aureus (strain MSSA476)
Q6GJR7 3.1e-89 262 64 1 189 3 ahpC Alkyl hydroperoxide reductase C Staphylococcus aureus (strain MRSA252)
P99074 3.1e-89 262 64 1 189 1 ahpC Alkyl hydroperoxide reductase C Staphylococcus aureus (strain N315)
P0A0B5 3.1e-89 262 64 1 189 3 ahpC Alkyl hydroperoxide reductase C Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HIR5 3.1e-89 262 64 1 189 3 ahpC Alkyl hydroperoxide reductase C Staphylococcus aureus (strain COL)
Q2YVK2 3.1e-89 262 64 1 189 3 ahpC Alkyl hydroperoxide reductase C Staphylococcus aureus (strain bovine RF122 / ET3-1)
P0A0B7 3.1e-89 262 64 1 189 1 ahpC Alkyl hydroperoxide reductase C Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FJN4 3.1e-89 262 64 1 189 3 ahpC Alkyl hydroperoxide reductase C Staphylococcus aureus (strain USA300)
Q49UT8 1.64e-88 260 63 1 189 3 ahpC Alkyl hydroperoxide reductase C Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q4L376 3.27e-88 259 62 1 189 3 ahpC Alkyl hydroperoxide reductase C Staphylococcus haemolyticus (strain JCSC1435)
Q8CMQ2 4.44e-88 259 62 1 189 3 ahpC Alkyl hydroperoxide reductase C Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HRY1 7.51e-88 258 62 1 189 3 ahpC Alkyl hydroperoxide reductase C Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P26830 1.82e-86 254 66 0 168 3 None Alkyl hydroperoxide reductase C (Fragment) Ferdinandcohnia aciditolerans (strain JCM 32973 / CCTCC AB 2017280 / YN-1)
Q02UU0 1.63e-83 248 59 0 187 1 ahpC Alkyl hydroperoxide reductase C Pseudomonas aeruginosa (strain UCBPP-PA14)
Q9NL98 5.95e-46 152 39 2 183 2 None Peroxiredoxin Ascaris suum
P35704 1e-45 152 40 2 182 1 Prdx2 Peroxiredoxin-2 Rattus norvegicus
Q8K3U7 6.16e-45 150 40 2 182 2 PRDX2 Peroxiredoxin-2 Cricetulus griseus
Q61171 1.1e-44 149 40 2 175 1 Prdx2 Peroxiredoxin-2 Mus musculus
P30048 2.49e-44 150 41 2 173 1 PRDX3 Thioredoxin-dependent peroxide reductase, mitochondrial Homo sapiens
Q9Z0V6 2.67e-44 150 41 2 173 1 Prdx3 Thioredoxin-dependent peroxide reductase, mitochondrial Rattus norvegicus
P20108 3.98e-44 150 41 2 173 1 Prdx3 Thioredoxin-dependent peroxide reductase, mitochondrial Mus musculus
Q5REY3 7.56e-44 149 41 2 173 2 PRDX3 Thioredoxin-dependent peroxide reductase, mitochondrial Pongo abelii
Q2PFZ3 3.61e-43 145 39 2 182 2 PRDX2 Peroxiredoxin-2 Macaca fascicularis
P32119 3.61e-43 145 39 2 182 1 PRDX2 Peroxiredoxin-2 Homo sapiens
Q9VEJ0 5.22e-43 146 36 3 184 1 Prx3 Thioredoxin-dependent peroxide reductase, mitochondrial Drosophila melanogaster
Q6ER94 8.99e-43 146 41 2 173 1 BAS1 2-Cys peroxiredoxin BAS1, chloroplastic Oryza sativa subsp. japonica
Q9C5R8 1.51e-42 146 38 2 183 2 At5g06290 2-Cys peroxiredoxin BAS1-like, chloroplastic Arabidopsis thaliana
Q96291 1.85e-42 145 38 2 183 1 BAS1 2-Cys peroxiredoxin BAS1, chloroplastic Arabidopsis thaliana
P35705 2.59e-42 145 40 2 172 1 PRDX3 Thioredoxin-dependent peroxide reductase, mitochondrial Bos taurus
P80602 3.51e-42 143 39 3 183 1 TSA 2-Cys peroxiredoxin BAS1, chloroplastic (Fragment) Triticum aestivum
Q9BGI3 4.36e-42 143 38 2 182 2 PRDX2 Peroxiredoxin-2 Bos taurus
Q96468 5.19e-42 143 39 3 183 2 BAS1 2-Cys peroxiredoxin BAS1, chloroplastic (Fragment) Hordeum vulgare
Q17172 8.83e-42 142 36 2 183 2 tsa-2 Peroxiredoxin 2 Brugia malayi
A0A0K3AUJ9 1.87e-41 141 37 2 183 1 prdx-2 Peroxiredoxin prdx-2 Caenorhabditis elegans
P0CB50 1.95e-41 141 38 3 184 1 PRDX1 Peroxiredoxin-1 Gallus gallus
Q1XDL4 2.34e-41 141 38 2 172 3 ycf42 Putative peroxiredoxin ycf42 Neopyropia yezoensis
Q63716 2.58e-41 140 36 3 183 1 Prdx1 Peroxiredoxin-1 Rattus norvegicus
Q9L3Q5 3.72e-41 140 40 2 181 1 prxU Selenocysteine-containing peroxiredoxin PrxU Peptoclostridium acidaminophilum
P35700 4.69e-41 140 36 3 183 1 Prdx1 Peroxiredoxin-1 Mus musculus
P51272 7.72e-41 139 39 2 172 3 ycf42 Putative peroxiredoxin ycf42 Porphyra purpurea
Q06830 1.05e-40 139 37 3 182 1 PRDX1 Peroxiredoxin-1 Homo sapiens
Q6B4U9 1.74e-40 139 37 3 182 1 PRDX1 Peroxiredoxin-1 Myotis lucifugus
O24364 2.4e-40 140 38 3 183 2 BAS1 2-Cys peroxiredoxin BAS1, chloroplastic Spinacia oleracea
Q9JKY1 3.88e-40 138 36 3 182 1 PRDX1 Peroxiredoxin-1 Cricetulus griseus
Q5E947 4.52e-40 137 37 2 167 2 PRDX1 Peroxiredoxin-1 Bos taurus
Q90384 5.02e-40 137 37 3 182 2 None Peroxiredoxin Cynops pyrrhogaster
P48822 1.67e-39 137 38 2 175 2 TSA1 Peroxiredoxin 1 Brugia malayi
Q26695 2.04e-39 136 37 3 178 2 None Thioredoxin peroxidase Trypanosoma brucei rhodesiense
Q8T6C4 5.13e-39 135 38 2 173 2 TPX Thioredoxin peroxidase Echinococcus granulosus
Q55624 5.2e-39 135 35 1 179 3 sll0755 Putative peroxiredoxin sll0755 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q9BGI2 2.52e-38 135 38 3 187 2 PRDX4 Peroxiredoxin-4 Bos taurus
O34564 3.13e-38 132 40 2 159 3 ykuU Putative peroxiredoxin YkuU Bacillus subtilis (strain 168)
Q13162 6.22e-38 134 37 3 187 1 PRDX4 Peroxiredoxin-4 Homo sapiens
Q6DV14 8.91e-38 132 35 2 167 2 PRDX1 Peroxiredoxin-1 Gekko japonicus
Q21824 9.41e-38 132 35 2 177 3 prdx-3 Probable peroxiredoxin prdx-3 Caenorhabditis elegans
O08807 1.14e-37 134 37 3 187 1 Prdx4 Peroxiredoxin-4 Mus musculus
Q9Z0V5 1.15e-37 134 37 3 187 2 Prdx4 Peroxiredoxin-4 Rattus norvegicus
O74887 1.88e-36 128 37 3 181 1 tpx1 Peroxiredoxin tpx1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q9V3P0 6.26e-36 127 35 2 180 1 Prx2 Peroxiredoxin 2 Drosophila melanogaster
A0A2Z5VKM8 1.03e-35 126 37 2 151 1 None 2-cysteine peroxiredoxin, chloroplastic Chattonella marina var. antiqua
P91883 1.25e-35 126 34 2 181 2 None Thioredoxin peroxidase Fasciola hepatica
Q9Y7F0 1.66e-35 126 34 2 181 2 TSA1 Peroxiredoxin TSA1-A Candida albicans (strain SC5314 / ATCC MYA-2876)
P0CU34 1.66e-35 126 34 2 181 2 TSA1B Peroxiredoxin TSA1-B Candida albicans (strain SC5314 / ATCC MYA-2876)
Q555L5 1.76e-35 127 35 2 177 1 prdx4 Peroxiredoxin-4 Dictyostelium discoideum
Q91191 9.66e-35 124 35 3 168 2 None Peroxiredoxin Oncorhynchus mykiss
Q5RC63 3.63e-34 122 36 1 166 2 PRDX2 Peroxiredoxin-2 Pongo abelii
A0R1V9 2.79e-33 120 35 2 167 1 MSMEG_4891 Alkyl hydroperoxide reductase C Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q04120 2.67e-32 117 33 2 175 1 TSA2 Peroxiredoxin TSA2 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P23161 3.68e-31 114 35 4 180 3 None Putative peroxiredoxin in rubredoxin operon Clostridium pasteurianum
P34760 8.75e-31 114 33 2 175 1 TSA1 Peroxiredoxin TSA1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P49537 3.25e-30 112 38 2 146 3 ycf42 Putative peroxiredoxin ycf42 Trieres chinensis
P57279 3.92e-30 112 34 3 176 3 BU182 Alkyl hydroperoxide reductase C Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
P19476 5.24e-30 113 30 2 171 1 None Putative peroxiredoxin Entamoeba histolytica (strain ATCC 30459 / HM-1:IMSS / ABRM)
P9WQB7 5.91e-30 111 34 2 157 1 ahpC Alkyl hydroperoxide reductase C Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQB6 5.91e-30 111 34 2 157 3 ahpC Alkyl hydroperoxide reductase C Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q89AS1 7.15e-28 106 34 3 172 3 bbp_171 Alkyl hydroperoxide reductase C Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
P21762 1.18e-27 105 35 3 150 1 ahpC Alkyl hydroperoxide reductase C Helicobacter pylori (strain ATCC 700392 / 26695)
Q8K9W0 1.97e-27 105 32 3 170 3 BUsg_176 Alkyl hydroperoxide reductase C Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P56876 9.84e-27 103 34 3 149 1 ahpC Alkyl hydroperoxide reductase C Helicobacter pylori (strain J99 / ATCC 700824)
P52552 1.49e-26 100 38 1 125 2 PRDX2 Peroxiredoxin-2 (Fragment) Sus scrofa
P72314 1.98e-26 99 66 0 68 3 ahpC Alkyl hydroperoxide reductase C (Fragment) Rhodospirillum rubrum
Q9WZR4 5.59e-24 97 33 4 167 3 TM_0807 Peroxiredoxin Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
A5IIX7 8.29e-24 96 32 4 167 3 Tpet_0121 Peroxiredoxin Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
Q979N7 1.08e-23 95 31 3 159 3 TV1123 Peroxiredoxin Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1)
Q974S8 5.73e-23 94 34 2 152 3 STK_05840 Peroxiredoxin 1 Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
O33665 6.04e-23 94 34 3 152 3 None Peroxiredoxin 2 Sulfuracidifex metallicus
Q55060 1.11e-22 93 31 4 154 3 None Peroxiredoxin 1 Sulfuracidifex metallicus
Q8SS85 1.39e-22 92 30 2 163 1 ECU03_1190 Putative thioredoxin peroxidase Encephalitozoon cuniculi (strain GB-M1)
A2BJD9 3.75e-22 92 31 4 147 3 Hbut_0228 Peroxiredoxin Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5)
Q9Y9L0 4.59e-22 92 34 4 149 1 APE_2278 Peroxiredoxin Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)
A8A9P0 4.62e-22 92 32 3 150 3 Igni_0459 Peroxiredoxin Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125)
O29969 4.98e-22 91 33 3 148 3 AF_0270 Peroxiredoxin Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q9UZV4 8.28e-22 91 34 3 147 3 PYRAB10420 Peroxiredoxin Pyrococcus abyssi (strain GE5 / Orsay)
P95895 1.25e-21 90 31 3 150 3 SSO2121 Peroxiredoxin Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
O58966 1.54e-21 90 35 3 147 1 ahpC Peroxiredoxin Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q96XS5 1.97e-21 90 31 3 148 3 STK_24420 Peroxiredoxin 2 Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
Q58146 2.36e-21 90 34 3 148 3 MJ0736 Peroxiredoxin Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q9HJL3 3.19e-21 89 31 3 153 3 Ta0954 Peroxiredoxin 2 Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165)
Q5JF30 1.24e-20 88 34 3 147 1 TK0537 Peroxiredoxin Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q74NC6 1.38e-20 88 33 3 153 3 NEQ191 Peroxiredoxin Nanoarchaeum equitans (strain Kin4-M)
A3DKL1 1.85e-20 88 33 4 148 3 Smar_0058 Peroxiredoxin Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1)
Q8U218 2.82e-20 87 33 3 147 3 PF1033 Peroxiredoxin Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q6L240 1.04e-19 85 31 3 150 3 PTO0377 Peroxiredoxin 1 Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828 / KAW 2/3)
Q8RCY5 1.11e-19 85 30 3 163 3 TTE0270 Peroxiredoxin 1 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q6L140 3.98e-19 84 28 3 158 3 PTO0727 Peroxiredoxin 2 Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828 / KAW 2/3)
Q9HKX0 2.28e-18 82 30 5 158 3 Ta0473 Peroxiredoxin 1 Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165)
O67024 2.38e-18 82 32 4 147 1 aq_858 Peroxiredoxin Aquifex aeolicus (strain VF5)
Q8PYP6 1.49e-17 80 30 3 162 3 MM_0814 Peroxiredoxin Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
O26262 2.09e-17 79 30 4 148 3 MTH_159 Peroxiredoxin Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
A4FWZ9 6.76e-17 78 31 3 147 3 MmarC5_0413 Peroxiredoxin Methanococcus maripaludis (strain C5 / ATCC BAA-1333)
A6UPH7 8.15e-17 78 31 3 147 3 Mevan_0492 Peroxiredoxin Methanococcus vannielii (strain ATCC 35089 / DSM 1224 / JCM 13029 / OCM 148 / SB)
Q6E2Z6 9.02e-17 78 32 5 158 2 None 1-Cys peroxiredoxin Medicago truncatula
O04005 9.66e-17 77 27 3 154 2 PER1 1-Cys peroxiredoxin PER1 Arabidopsis thaliana
Q6LY19 1.76e-16 77 31 3 143 3 MMP1174 Peroxiredoxin Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
Q57109 1.91e-16 77 30 5 150 3 MTBMA_c06100 Peroxiredoxin Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg)
P52574 5.94e-16 75 30 5 159 2 None Probable 1-Cys peroxiredoxin Syntrichia ruralis
P34227 1.03e-15 75 30 4 159 1 PRX1 Peroxiredoxin PRX1, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
A2SZW8 1.81e-15 74 27 4 168 2 PER1 1-Cys peroxiredoxin PER1 Zea mays
Q8R844 6.84e-15 73 28 4 166 3 TTE2186 Peroxiredoxin 2 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
P52572 9.75e-15 72 27 4 153 2 PER1 1-Cys peroxiredoxin PER1 Hordeum vulgare
P52571 2.15e-14 71 28 4 153 2 None Probable 1-Cys peroxiredoxin (Fragment) Bromus secalinus
P0C5C9 3.17e-14 71 27 3 156 2 Os07g0638300 1-Cys peroxiredoxin A Oryza sativa subsp. japonica
P0C5C8 3.44e-14 71 27 3 156 2 OsI_27030 1-Cys peroxiredoxin A Oryza sativa subsp. indica
Q6W8Q2 1.12e-13 69 27 4 153 2 PER1 1-Cys peroxiredoxin PER1 Triticum aestivum
Q8KBN8 4.26e-13 68 29 3 151 3 CT1747 Peroxiredoxin Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q73RS4 7.62e-13 67 30 2 137 3 TDE_0011 Peroxiredoxin Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
P9WIE3 1.11e-12 65 33 2 112 1 ahpE Alkyl hydroperoxide reductase E Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WIE2 1.11e-12 65 33 2 112 3 ahpE Alkyl hydroperoxide reductase E Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P65689 1.11e-12 65 33 2 112 3 ahpE Alkyl hydroperoxide reductase E Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P0C5D0 1.4e-12 67 27 3 156 3 OsI_026085 1-Cys peroxiredoxin B Oryza sativa subsp. indica
P0C5D1 3.43e-12 65 27 3 156 1 Os07g0638400 1-Cys peroxiredoxin B Oryza sativa subsp. japonica
O35244 1.75e-11 63 28 3 157 1 Prdx6 Peroxiredoxin-6 Rattus norvegicus
Q9LU86 4.02e-11 62 30 3 140 1 PRXQ Peroxiredoxin Q, chloroplastic Arabidopsis thaliana
P52570 6.74e-11 62 27 5 168 2 TSA 1-Cys peroxiredoxin Onchocerca volvulus
O17433 7.04e-11 62 27 5 171 1 None 1-Cys peroxiredoxin Dirofilaria immitis
Q5ZJF4 9.29e-11 62 28 4 157 2 PRDX6 Peroxiredoxin-6 Gallus gallus
O08709 1.21e-10 61 27 3 157 1 Prdx6 Peroxiredoxin-6 Mus musculus
Q54SE2 1.35e-10 61 28 4 151 3 DDB_G0282517 1-Cys peroxiredoxin Dictyostelium discoideum
Q5R7E0 4.16e-10 60 28 4 158 2 PRDX6 Peroxiredoxin-6 Pongo abelii
Q75SY5 7.1e-10 59 31 3 119 2 AFP1 Peroxiredoxin Q, chloroplastic Gentiana triflora
P30041 7.6e-10 59 27 3 157 1 PRDX6 Peroxiredoxin-6 Homo sapiens
Q2PFL9 9.48e-10 59 27 3 157 2 PRDX6 Peroxiredoxin-6 Macaca fascicularis
Q5S1S6 1.54e-09 58 26 2 123 2 PRX1 Peroxiredoxin Q, chloroplastic Triticum aestivum
O77834 1.63e-09 58 26 3 157 1 PRDX6 Peroxiredoxin-6 Bos taurus
Q9MB35 1.93e-09 57 27 2 122 1 PRXQ Peroxiredoxin Q, chloroplastic (Fragment) Sedum lineare
Q6UBI3 4.48e-09 57 29 2 106 2 PRXQ Peroxiredoxin Q, chloroplastic Suaeda salsa
Q6QPJ6 7.45e-09 56 29 2 106 1 PRXQ Peroxiredoxin Q, chloroplastic Populus jackii
Q9TSX9 1.15e-08 56 25 3 157 2 PRDX6 Peroxiredoxin-6 Sus scrofa
P0C5D5 1.39e-08 55 26 2 123 2 Os06g0196300 Peroxiredoxin Q, chloroplastic Oryza sativa subsp. japonica
P0C5D4 1.39e-08 55 26 2 123 3 OsI_22010 Putative peroxiredoxin Q, chloroplastic Oryza sativa subsp. indica
Q8P9V9 9.99e-08 52 29 3 118 1 bcp Peroxiredoxin Bcp Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q83CY8 5.83e-07 50 26 3 114 1 bcp Putative peroxiredoxin bcp Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Q796Y8 1.78e-06 48 28 4 119 3 ygaF Peroxiredoxin Bcp Bacillus subtilis (strain 168)
Q9ZMU4 3.78e-06 48 27 4 133 3 bcp Putative peroxiredoxin bcp Helicobacter pylori (strain J99 / ATCC 700824)
Q53212 6.08e-06 48 35 3 87 3 NGR_a01200 Peroxiredoxin y4vD Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P55979 1.21e-05 46 27 3 131 3 bcp Putative peroxiredoxin bcp Helicobacter pylori (strain ATCC 700392 / 26695)
P83117 2.47e-05 43 76 0 25 1 ahpC Alkyl hydroperoxide reductase C (Fragment) Delftia acidovorans
O69777 5.59e-05 45 38 3 78 3 None Peroxiredoxin Rhizobium etli
P0AE55 0.000118 43 26 4 138 3 bcp Putative peroxiredoxin bcp Shigella flexneri
P0AE52 0.000118 43 26 4 138 1 bcp Peroxiredoxin Bcp Escherichia coli (strain K12)
P0AE53 0.000118 43 26 4 138 3 bcp Putative peroxiredoxin bcp Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AE54 0.000118 43 26 4 138 3 bcp Putative peroxiredoxin bcp Escherichia coli O157:H7

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS10545
Feature type CDS
Gene ahpC
Product alkyl hydroperoxide reductase subunit C
Location 240558 - 241121 (strand: -1)
Length 564 (nucleotides) / 187 (amino acids)

Contig

Accession term accessions NZ_VXKB01000002 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 573139 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1468
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00578 AhpC/TSA family
PF10417 C-terminal domain of 1-Cys peroxiredoxin

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0450 Defense mechanisms (V) V Alkyl hydroperoxide reductase subunit AhpC (peroxiredoxin)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K24119 NADH-dependent peroxiredoxin subunit C [EC:1.11.1.26] - -

Protein Sequence

MSLINTPIKPFKNMAFKNGEFVEVTEKDTEGKWSIFFFYPADFTFVCPTELGDLADHYDEFQKMGVDIYSVSTDTHFTHKAWHSSSDTIGKIKYTMIGDPTGALTRNFDNMRELEGLADRGTFVIDPQGIIQAIEVTAEGIGRDASDLLRKVKAAQYVASHPGEVCPAKWKEGEATLSPSLDLVGKI

Flanking regions ( +/- flanking 50bp)

CCTCTCCTGTTTGCGTATTGTTGTCCTCAACGAAACAGGAGGAGTTACCTATGTCTTTAATCAATACCCCAATCAAACCTTTCAAAAACATGGCATTCAAAAACGGTGAATTTGTTGAAGTCACTGAAAAAGACACTGAAGGCAAGTGGAGCATTTTCTTCTTTTATCCGGCTGACTTCACGTTTGTCTGCCCGACTGAGTTAGGCGACCTGGCTGACCATTACGACGAATTCCAAAAAATGGGTGTGGATATCTATTCTGTTTCAACAGATACCCATTTCACACACAAAGCATGGCACAGCAGCTCTGACACCATCGGCAAAATCAAATACACCATGATCGGTGACCCGACAGGCGCACTGACACGCAACTTCGACAATATGCGTGAGCTGGAAGGTCTGGCTGACCGCGGTACGTTTGTTATTGACCCGCAGGGCATCATTCAGGCGATTGAAGTCACCGCTGAAGGTATTGGCCGTGATGCCTCTGACCTGCTGCGTAAAGTCAAAGCCGCGCAGTATGTTGCAAGCCATCCGGGTGAAGTCTGCCCTGCCAAATGGAAAGAAGGCGAAGCGACACTGTCTCCGTCACTGGACCTGGTCGGTAAAATCTGAGACCCGTCTTCTTTTATATTAATAATTGTTATCGGGTGCATTTGCACCCG