Homologs in group_3046

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_18160 FBDBKF_18160 94.9 Morganella morganii S1 fimA Pilin (type 1 fimbrial protein)
EHELCC_16860 EHELCC_16860 94.9 Morganella morganii S2 fimA Pilin (type 1 fimbrial protein)
NLDBIP_17590 NLDBIP_17590 94.9 Morganella morganii S4 fimA Pilin (type 1 fimbrial protein)
LHKJJB_17510 LHKJJB_17510 94.9 Morganella morganii S3 fimA Pilin (type 1 fimbrial protein)
HKOGLL_17325 HKOGLL_17325 94.9 Morganella morganii S5 fimA Pilin (type 1 fimbrial protein)

Distribution of the homologs in the orthogroup group_3046

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3046

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q03011 5.75e-26 101 38 8 200 1 mrpA Major MR/P fimbria protein Proteus mirabilis (strain HI4320)
P62605 5.23e-19 83 29 5 198 3 pilC Type-1 fimbrial protein, C chain Escherichia coli
P62606 5.23e-19 83 29 5 198 3 pilC Type-1 fimbrial protein, C chain Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q04681 8.49e-18 80 32 10 204 1 pmfA Major fimbrial subunit Proteus mirabilis (strain HI4320)
P13421 2.5e-16 76 34 9 201 1 smfA Fimbria A protein Serratia marcescens
P04127 1.52e-15 74 30 7 208 1 papA Pap fimbrial major pilin protein Escherichia coli
Q47223 2.79e-15 73 34 7 167 1 fimA Type-1 fimbrial protein, A chain Escherichia coli
P12903 3.64e-15 73 35 3 119 1 fim Fimbrial subunit type 1 Klebsiella pneumoniae
P04740 4.27e-15 73 32 6 180 3 KS71A KS71A fimbrillin Escherichia coli
P42184 1.12e-14 71 33 7 174 1 prsA PRS fimbrial major pilin protein (Fragment) Escherichia coli
P12730 2.38e-14 71 26 4 198 1 sfaA S-fimbrial protein subunit SfaA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P04128 3.56e-14 70 33 3 125 1 fimA Type-1 fimbrial protein, A chain Escherichia coli (strain K12)
P12266 1.22e-13 69 34 4 129 1 None Fimbrial subunit type 1 Klebsiella pneumoniae
P62607 9.45e-12 64 30 6 177 3 F7-2 F7-2 fimbrial protein Escherichia coli
P62608 9.45e-12 64 30 6 177 3 F7-2 F7-2 fimbrial protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P53521 1.42e-09 58 29 6 168 3 pmfF Putative minor fimbrial subunit PmfF Proteus mirabilis (strain HI4320)
Q8X5K5 8.28e-09 56 33 3 115 2 lpfA Probable major fimbrial subunit LpfA Escherichia coli O157:H7
P37921 1.17e-08 55 32 2 102 1 fimA Type-1 fimbrial protein, A chain Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P43660 2.31e-08 54 26 4 172 3 lpfA Long polar fimbria protein A Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P37920 4.59e-08 54 32 2 102 3 fimA Type-1 fimbrial protein, A chain Salmonella typhi
P21413 1.32e-06 50 30 11 179 3 fasA Fimbrial protein 987P Escherichia coli
P55223 1.89e-06 49 27 6 188 3 None Fimbrial subunit type 1 Salmonella typhimurium
P37909 7.45e-06 48 25 7 190 1 ybgD Uncharacterized fimbrial-like protein YbgD Escherichia coli (strain K12)
P39834 7.02e-05 45 26 6 168 3 ygiL Uncharacterized fimbrial-like protein YgiL Escherichia coli (strain K12)
P39264 0.000273 43 26 4 160 1 fimI Fimbrin-like protein FimI Escherichia coli (strain K12)
Q8X5L0 0.000448 42 26 10 208 2 lpfE Probable fimbrial subunit LpfE Escherichia coli O157:H7

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS10365
Feature type CDS
Gene -
Product fimbrial protein
Location 184298 - 184894 (strand: -1)
Length 597 (nucleotides) / 198 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000002
Length 573139 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3046
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF00419 Fimbrial protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3539 Cell motility (N) N Pilin (type 1 fimbrial protein)

Protein Sequence

MKLQKVLLSVVLGSLFTVGLAQAEDPVTPAAPEVKSGLGTVHFKGYINNVPCSIDSKFLDQTVDFGEISRNELTTGTYRTDSKNFNIELKNCDTTTYKTAQIQFTAPTIELKDGTATSKYVGLGSIQNAGIALTDSGGKAIELGSRFPAEKYTLNGGKDQITPLNFAAYVKGNQSAVAGEQATTGRFDTPVNFQIFYQ

Flanking regions ( +/- flanking 50bp)

ATAAAACATTACTTTTAACACTGACAAATATCCCTGATAAAGGAAATAACATGAAACTCCAGAAAGTATTACTCTCAGTTGTCCTGGGATCATTATTTACTGTCGGCTTAGCTCAAGCTGAAGATCCGGTTACCCCTGCTGCACCAGAAGTAAAAAGCGGTCTGGGTACTGTTCATTTTAAAGGTTACATTAATAACGTACCTTGCTCTATTGATAGTAAATTCCTGGACCAGACAGTTGATTTCGGTGAAATCAGCCGTAATGAATTAACTACCGGTACTTACCGTACTGATAGCAAGAATTTTAATATTGAACTGAAAAACTGTGACACCACAACATATAAAACAGCTCAGATTCAATTTACAGCACCAACTATCGAACTGAAAGATGGTACTGCAACCTCTAAATATGTTGGTCTGGGTTCTATTCAGAATGCCGGTATCGCACTGACTGACAGCGGTGGTAAAGCAATTGAACTGGGTTCACGTTTCCCGGCTGAAAAATACACCCTGAACGGTGGTAAAGATCAAATCACTCCGCTGAACTTTGCAGCCTATGTGAAAGGTAATCAGTCTGCTGTTGCCGGTGAACAAGCAACAACAGGTCGTTTCGATACCCCGGTTAACTTCCAGATTTTCTATCAATAACAGGATCGTTACTGATTAAAGATTGAATATATGCAGTGGTATGCACGGAC