Homologs in group_191

Help

8 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_08800 FBDBKF_08800 89.8 Morganella morganii S1 ridA 2-iminobutanoate/2-iminopropanoate deaminase
EHELCC_12725 EHELCC_12725 89.8 Morganella morganii S2 ridA 2-iminobutanoate/2-iminopropanoate deaminase
NLDBIP_13065 NLDBIP_13065 89.8 Morganella morganii S4 ridA 2-iminobutanoate/2-iminopropanoate deaminase
LHKJJB_13490 LHKJJB_13490 89.8 Morganella morganii S3 ridA 2-iminobutanoate/2-iminopropanoate deaminase
HKOGLL_11540 HKOGLL_11540 89.8 Morganella morganii S5 ridA 2-iminobutanoate/2-iminopropanoate deaminase
PMI_RS05960 PMI_RS05960 29.3 Proteus mirabilis HI4320 - RidA family protein
PMI_RS17070 PMI_RS17070 50.0 Proteus mirabilis HI4320 - RidA family protein
PMI_RS17210 PMI_RS17210 78.7 Proteus mirabilis HI4320 - RidA family protein

Distribution of the homologs in the orthogroup group_191

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_191

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7CP78 2.06e-75 222 84 1 129 1 ridA 2-iminobutanoate/2-iminopropanoate deaminase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0AF95 2.35e-72 214 82 1 129 3 yjgF 2-iminobutanoate/2-iminopropanoate deaminase Shigella flexneri
P0AF93 2.35e-72 214 82 1 129 1 ridA 2-iminobutanoate/2-iminopropanoate deaminase Escherichia coli (strain K12)
P0AF94 2.35e-72 214 82 1 129 3 yjgF 2-iminobutanoate/2-iminopropanoate deaminase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P44839 9.69e-72 213 81 0 129 1 HI_0719 RutC family protein HI_0719 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9L6B5 1.68e-71 213 80 0 128 3 PM1466 RutC family protein PM1466 Pasteurella multocida (strain Pm70)
P0AGL4 2.21e-57 177 67 1 128 3 tdcF Putative reactive intermediate deaminase TdcF Shigella flexneri
P0AGL2 2.21e-57 177 67 1 128 1 tdcF Putative reactive intermediate deaminase TdcF Escherichia coli (strain K12)
P0AGL3 2.21e-57 177 67 1 128 3 tdcF Putative reactive intermediate deaminase TdcF Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8U308 3.26e-45 146 55 2 130 1 ridA 2-iminobutanoate/2-iminopropanoate deaminase Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
O58584 3.99e-44 143 54 2 130 1 PH0854 RutC family protein PH0854 Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q9UZA3 2.73e-41 136 51 2 128 3 PYRAB12510 RutC family protein PYRAB12510 Pyrococcus abyssi (strain GE5 / Orsay)
P37552 1.46e-38 129 48 1 129 1 ridA 2-iminobutanoate/2-iminopropanoate deaminase Bacillus subtilis (strain 168)
P52761 7.35e-37 125 50 2 127 3 slr0709 RutC family protein slr0709 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q8K9H7 1.11e-36 124 44 1 129 3 BUsg_359 RutC family protein BUsg_359 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P57452 1.13e-36 124 45 1 129 3 BU371 RutC family protein BU371 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q9ZKQ6 2.28e-35 121 47 2 129 3 jhp_0879 RutC family protein jhp_0879 Helicobacter pylori (strain J99 / ATCC 700824)
P52758 1.09e-34 119 47 2 127 1 RIDA 2-iminobutanoate/2-iminopropanoate deaminase Homo sapiens
O25598 1.52e-34 119 46 2 129 3 HP_0944 RutC family protein HP_0944 Helicobacter pylori (strain ATCC 700392 / 26695)
P55654 3.8e-33 115 44 2 126 3 NGR_a01620 RutC family protein y4sK Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P52760 6.85e-33 115 45 2 129 1 Rida 2-iminobutanoate/2-iminopropanoate deaminase Mus musculus
Q89AG0 7.08e-33 115 44 2 128 3 bbp_334 RutC family protein bbp_334 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
P52759 8.18e-33 115 48 2 127 1 Rida 2-iminobutanoate/2-iminopropanoate deaminase Rattus norvegicus
Q3T114 8.36e-33 115 47 2 127 2 RIDA 2-iminobutanoate/2-iminopropanoate deaminase Bos taurus
Q973T6 1.16e-32 114 44 2 125 1 STK_08110 RutC family protein STK_08110 Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
Q97U19 1.55e-32 114 45 2 127 3 SSO3206 RutC family protein SSO3206 Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
P80601 1.17e-31 112 45 2 127 1 RIDA 2-iminobutanoate/2-iminopropanoate deaminase Capra hircus
O52178 1.64e-31 111 46 3 128 3 dfrA Protein DfrA Myxococcus xanthus
O34133 1.66e-31 111 47 2 125 3 aldR Putative regulator AldR Lactococcus lactis subsp. lactis (strain IL1403)
Q10121 1.78e-31 112 43 1 125 3 C23G10.2 RutC family protein C23G10.2 Caenorhabditis elegans
A0A1J1DL12 6.5e-31 110 42 2 126 1 MAG133 2-iminobutanoate/2-iminopropanoate deaminase Dermatophagoides farinae
P97117 1.52e-29 106 45 1 127 3 None RutC family protein in leuC 5'region Leuconostoc mesenteroides subsp. cremoris
O66689 7.16e-27 99 40 1 124 3 aq_364 RutC family protein aq_364 Aquifex aeolicus (strain VF5)
Q94JQ4 7.45e-27 101 44 2 125 1 RIDA Reactive Intermediate Deaminase A, chloroplastic Arabidopsis thaliana
P40431 1.57e-26 99 44 3 129 3 None RutC family protein in vnfA 5'region Azotobacter vinelandii
Q9V3W0 5.96e-26 97 44 2 126 2 UK114 RutC family protein UK114 Drosophila melanogaster
P40185 3.39e-24 93 40 1 125 1 MMF1 Protein MMF1, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P40037 2.37e-21 85 39 1 107 1 HMF1 Protein HMF1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q6FFZ5 1.82e-19 80 34 2 125 3 rutC 3-aminoacrylate deaminase RutC Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
O43003 2.1e-17 76 37 4 124 3 mmf1 Protein mmf1, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)
A6T7A0 1.5e-15 70 31 2 125 3 rutC 3-aminoacrylate deaminase RutC Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XXN2 2.86e-15 70 31 2 125 3 rutC 3-aminoacrylate deaminase RutC Klebsiella pneumoniae (strain 342)
D3RKL2 2.98e-15 70 31 2 125 3 rutC 3-aminoacrylate deaminase RutC Klebsiella variicola (strain At-22)
B1M5I6 3.76e-15 69 32 2 114 3 rutC 3-aminoacrylate deaminase RutC Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
D3QPK3 5.6e-15 69 32 2 125 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli O55:H7 (strain CB9615 / EPEC)
Q8XAU5 5.6e-15 69 32 2 125 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli O157:H7
B7N3G6 5.66e-15 69 32 2 125 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q32HQ1 9.49e-15 68 32 2 125 3 rutC 3-aminoacrylate deaminase RutC Shigella dysenteriae serotype 1 (strain Sd197)
Q1RDK7 9.49e-15 68 32 2 125 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli (strain UTI89 / UPEC)
B1LIZ5 9.49e-15 68 32 2 125 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli (strain SMS-3-5 / SECEC)
D2NGI7 9.49e-15 68 32 2 125 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli O150:H5 (strain SE15)
P0AFQ5 9.49e-15 68 32 2 125 1 rutC 3-aminoacrylate deaminase RutC Escherichia coli (strain K12)
B1IV87 9.49e-15 68 32 2 125 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0AFQ6 9.49e-15 68 32 2 125 1 rutC 3-aminoacrylate deaminase RutC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TJ57 9.49e-15 68 32 2 125 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli O6:K15:H31 (strain 536 / UPEC)
D5CZH0 9.49e-15 68 32 2 125 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli O18:K1:H7 (strain IHE3034 / ExPEC)
A1A9R5 9.49e-15 68 32 2 125 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli O1:K1 / APEC
A7ZYW5 9.49e-15 68 32 2 125 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli O9:H4 (strain HS)
B1X9D1 9.49e-15 68 32 2 125 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli (strain K12 / DH10B)
C9QZ66 9.49e-15 68 32 2 125 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli (strain ATCC 33849 / DSM 4235 / NCIMB 12045 / K12 / DH1)
C4ZQD8 9.49e-15 68 32 2 125 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli (strain K12 / MC4100 / BW2952)
C6UFC1 9.49e-15 68 32 2 125 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli (strain B / REL606)
C6EHJ7 9.49e-15 68 32 2 125 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli (strain B / BL21-DE3)
B7M8Z5 9.49e-15 68 32 2 125 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli O8 (strain IAI1)
B7MTF3 9.49e-15 68 32 2 125 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli O81 (strain ED1a)
B7NLB6 9.49e-15 68 32 2 125 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7MIF7 9.49e-15 68 32 2 125 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli O45:K1 (strain S88 / ExPEC)
D3H123 9.49e-15 68 32 2 125 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli O44:H18 (strain 042 / EAEC)
B7UNZ3 9.49e-15 68 32 2 125 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZKB5 9.49e-15 68 32 2 125 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli O139:H28 (strain E24377A / ETEC)
C8U5H2 9.49e-15 68 32 2 125 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli O103:H2 (strain 12009 / EHEC)
Q9UR06 1.58e-14 68 33 4 130 3 mmf2 Protein mmf2, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)
C5B0U7 1.81e-14 68 31 2 114 3 rutC 3-aminoacrylate deaminase RutC Methylorubrum extorquens (strain ATCC 14718 / DSM 1338 / JCM 2805 / NCIMB 9133 / AM1)
A9W3H9 2.27e-14 67 30 2 114 3 rutC 3-aminoacrylate deaminase RutC Methylorubrum extorquens (strain PA1)
C7CM34 2.27e-14 67 30 2 114 3 rutC 3-aminoacrylate deaminase RutC Methylorubrum extorquens (strain DSM 6343 / CIP 106787 / DM4)
B7KWT5 2.27e-14 67 30 2 114 3 rutC 3-aminoacrylate deaminase RutC Methylorubrum extorquens (strain CM4 / NCIMB 13688)
B7LFC0 2.93e-14 67 32 2 125 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli (strain 55989 / EAEC)
C8TNC0 2.93e-14 67 32 2 125 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli O26:H11 (strain 11368 / EHEC)
C8UMM6 2.93e-14 67 32 2 125 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli O111:H- (strain 11128 / EHEC)
B1ZB17 3.38e-14 67 30 2 114 3 rutC 3-aminoacrylate deaminase RutC Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
A8IAD2 4.75e-14 67 28 2 129 3 rutC 3-aminoacrylate deaminase RutC Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
B6I986 8.96e-14 66 31 2 125 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli (strain SE11)
C5CN81 1.27e-13 65 33 2 114 3 rutC 3-aminoacrylate deaminase RutC Variovorax paradoxus (strain S110)
D5CE34 1.63e-13 65 30 2 125 3 rutC 3-aminoacrylate deaminase RutC Enterobacter cloacae subsp. cloacae (strain ATCC 13047 / DSM 30054 / NBRC 13535 / NCTC 10005 / WDCM 00083 / NCDC 279-56)
Q48MQ6 2.13e-13 65 31 2 114 3 rutC 3-aminoacrylate deaminase RutC Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q7CWX2 2.3e-13 65 29 2 125 3 rutC 3-aminoacrylate deaminase RutC Agrobacterium fabrum (strain C58 / ATCC 33970)
Q4ZXR9 3.72e-13 64 31 2 114 3 rutC 3-aminoacrylate deaminase RutC Pseudomonas syringae pv. syringae (strain B728a)
A4W923 4.67e-13 64 29 2 125 3 rutC 3-aminoacrylate deaminase RutC Enterobacter sp. (strain 638)
C9Y0S5 5.1e-13 64 29 2 125 3 rutC 3-aminoacrylate deaminase RutC Cronobacter turicensis (strain DSM 18703 / CCUG 55852 / LMG 23827 / z3032)
Q83LK7 6.23e-13 63 31 2 125 3 rutC 3-aminoacrylate deaminase RutC Shigella flexneri
Q0T624 6.23e-13 63 31 2 125 3 rutC 3-aminoacrylate deaminase RutC Shigella flexneri serotype 5b (strain 8401)
D2AC41 6.23e-13 63 31 2 125 3 rutC 3-aminoacrylate deaminase RutC Shigella flexneri serotype X (strain 2002017)
D0LI57 6.31e-13 63 32 3 126 3 rutC 3-aminoacrylate deaminase RutC Haliangium ochraceum (strain DSM 14365 / JCM 11303 / SMP-2)
B9JLT7 8.15e-13 63 32 2 114 3 rutC 3-aminoacrylate deaminase RutC Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
D4GEU6 9.57e-13 63 30 2 114 3 rutC 3-aminoacrylate deaminase RutC Pantoea ananatis (strain LMG 20103)
A7ME54 2.35e-12 62 28 2 125 3 rutC 3-aminoacrylate deaminase RutC Cronobacter sakazakii (strain ATCC BAA-894)
A4VQH6 4.23e-12 62 31 3 121 3 rutC 3-aminoacrylate deaminase RutC Stutzerimonas stutzeri (strain A1501)
B0SW61 8.21e-12 61 29 2 124 3 rutC 3-aminoacrylate deaminase RutC Caulobacter sp. (strain K31)
A8GCT4 1.12e-11 60 28 2 114 3 rutC 3-aminoacrylate deaminase RutC Serratia proteamaculans (strain 568)
A1JMX4 5.31e-11 58 25 2 124 3 rutC 3-aminoacrylate deaminase RutC Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
D5VGV2 5.28e-10 56 28 2 124 3 rutC 3-aminoacrylate deaminase RutC Caulobacter segnis (strain ATCC 21756 / DSM 7131 / JCM 7823 / NBRC 15250 / LMG 17158 / TK0059)
Q9KWS2 5.78e-08 51 28 4 135 1 amnD 2-aminomuconate deaminase Pseudomonas sp.
P0AEB9 1.68e-07 49 32 1 82 3 yoaB RutC family protein YoaB Shigella flexneri
P0AEB7 1.68e-07 49 32 1 82 3 yoaB RutC family protein YoaB Escherichia coli (strain K12)
P0AEB8 1.68e-07 49 32 1 82 3 yoaB RutC family protein YoaB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
O30825 2.86e-05 43 27 2 93 3 HD_0322 RutC family protein HD_0322 Haemophilus ducreyi (strain 35000HP / ATCC 700724)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS10020
Feature type CDS
Gene ridA
Product 2-iminobutanoate/2-iminopropanoate deaminase
Location 111087 - 111476 (strand: -1)
Length 390 (nucleotides) / 129 (amino acids)

Contig

Accession term accessions NZ_VXKB01000002 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 573139 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_191
Orthogroup size 9
N. genomes 7

Actions

Genomic region

Domains

PF01042 Endoribonuclease L-PSP

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0251 Defense mechanisms (V) V Enamine deaminase RidA, house cleaning of reactive enamine intermediates, YjgF/YER057c/UK114 family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K09022 2-iminobutanoate/2-iminopropanoate deaminase [EC:3.5.99.10] - -

Protein Sequence

MTKVIATENAPAAIGPYVQAVDLGNMVMTSGQIPVDPKTGLVADDVTAQARQSLENIKAIIEKAGLKVADIVKTTVFVKDLNDFTTVNAAYEAFFKENNAAHFPARSCVEVARLPKDVKLEIEAIAVRK

Flanking regions ( +/- flanking 50bp)

ACCGCGTTTTTAAAAACTTAACAGCAATAATAACCCTACAGGAGTCCGTAATGACTAAAGTAATCGCAACAGAAAACGCACCAGCAGCAATCGGCCCATATGTACAGGCTGTAGACCTGGGTAACATGGTTATGACTTCAGGTCAGATCCCGGTTGACCCTAAAACAGGTCTGGTTGCAGATGACGTTACTGCTCAGGCACGCCAATCTCTGGAAAACATCAAAGCAATCATCGAGAAAGCAGGCCTGAAAGTTGCTGATATCGTGAAAACAACTGTTTTCGTTAAAGATCTGAATGACTTCACTACTGTGAACGCAGCATACGAAGCCTTCTTCAAAGAGAACAACGCAGCGCATTTCCCTGCACGTTCTTGCGTTGAAGTTGCCCGTCTGCCAAAAGACGTGAAATTAGAAATCGAAGCAATCGCAGTCCGTAAATAATTACTGCGCTTTCTGAGAACGACAGTAAAAAAAGCATCTCTTTCAGAGAT