Homologs in group_1407

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_08685 FBDBKF_08685 93.3 Morganella morganii S1 rpsO 30S ribosomal protein S15
EHELCC_12840 EHELCC_12840 93.3 Morganella morganii S2 rpsO 30S ribosomal protein S15
NLDBIP_13180 NLDBIP_13180 93.3 Morganella morganii S4 rpsO 30S ribosomal protein S15
LHKJJB_13375 LHKJJB_13375 93.3 Morganella morganii S3 rpsO 30S ribosomal protein S15
HKOGLL_11655 HKOGLL_11655 93.3 Morganella morganii S5 rpsO 30S ribosomal protein S15
PMI_RS17040 PMI_RS17040 83.1 Proteus mirabilis HI4320 rpsO 30S ribosomal protein S15

Distribution of the homologs in the orthogroup group_1407

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1407

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A8G910 2.6e-51 158 86 0 89 3 rpsO Small ribosomal subunit protein uS15 Serratia proteamaculans (strain 568)
O34274 6.39e-51 157 85 0 89 3 rpsO Small ribosomal subunit protein uS15 Yersinia enterocolitica
A1JIX2 6.39e-51 157 85 0 89 3 rpsO Small ribosomal subunit protein uS15 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
C6DKK6 6.98e-51 157 85 0 89 3 rpsO Small ribosomal subunit protein uS15 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q3YX76 1.13e-50 157 84 0 89 3 rpsO Small ribosomal subunit protein uS15 Shigella sonnei (strain Ss046)
P0ADZ6 1.13e-50 157 84 0 89 3 rpsO Small ribosomal subunit protein uS15 Shigella flexneri
Q0T0B6 1.13e-50 157 84 0 89 3 rpsO Small ribosomal subunit protein uS15 Shigella flexneri serotype 5b (strain 8401)
Q32BG8 1.13e-50 157 84 0 89 3 rpsO Small ribosomal subunit protein uS15 Shigella dysenteriae serotype 1 (strain Sd197)
Q31W44 1.13e-50 157 84 0 89 3 rpsO Small ribosomal subunit protein uS15 Shigella boydii serotype 4 (strain Sb227)
B2U210 1.13e-50 157 84 0 89 3 rpsO Small ribosomal subunit protein uS15 Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LR34 1.13e-50 157 84 0 89 3 rpsO Small ribosomal subunit protein uS15 Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1R6H3 1.13e-50 157 84 0 89 3 rpsO Small ribosomal subunit protein uS15 Escherichia coli (strain UTI89 / UPEC)
B1LFR7 1.13e-50 157 84 0 89 3 rpsO Small ribosomal subunit protein uS15 Escherichia coli (strain SMS-3-5 / SECEC)
B6I1P0 1.13e-50 157 84 0 89 3 rpsO Small ribosomal subunit protein uS15 Escherichia coli (strain SE11)
B7NDF1 1.13e-50 157 84 0 89 3 rpsO Small ribosomal subunit protein uS15 Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0ADZ4 1.13e-50 157 84 0 89 1 rpsO Small ribosomal subunit protein uS15 Escherichia coli (strain K12)
B1IQV6 1.13e-50 157 84 0 89 3 rpsO Small ribosomal subunit protein uS15 Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0ADZ5 1.13e-50 157 84 0 89 3 rpsO Small ribosomal subunit protein uS15 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TCU4 1.13e-50 157 84 0 89 3 rpsO Small ribosomal subunit protein uS15 Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AG70 1.13e-50 157 84 0 89 3 rpsO Small ribosomal subunit protein uS15 Escherichia coli O1:K1 / APEC
A8A4Y1 1.13e-50 157 84 0 89 3 rpsO Small ribosomal subunit protein uS15 Escherichia coli O9:H4 (strain HS)
B1XGX7 1.13e-50 157 84 0 89 3 rpsO Small ribosomal subunit protein uS15 Escherichia coli (strain K12 / DH10B)
C4ZSQ6 1.13e-50 157 84 0 89 3 rpsO Small ribosomal subunit protein uS15 Escherichia coli (strain K12 / MC4100 / BW2952)
B7M073 1.13e-50 157 84 0 89 3 rpsO Small ribosomal subunit protein uS15 Escherichia coli O8 (strain IAI1)
B7N0V0 1.13e-50 157 84 0 89 3 rpsO Small ribosomal subunit protein uS15 Escherichia coli O81 (strain ED1a)
B7NKN4 1.13e-50 157 84 0 89 3 rpsO Small ribosomal subunit protein uS15 Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7LGI7 1.13e-50 157 84 0 89 3 rpsO Small ribosomal subunit protein uS15 Escherichia coli (strain 55989 / EAEC)
B7MB86 1.13e-50 157 84 0 89 3 rpsO Small ribosomal subunit protein uS15 Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UJ60 1.13e-50 157 84 0 89 3 rpsO Small ribosomal subunit protein uS15 Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZS62 1.13e-50 157 84 0 89 3 rpsO Small ribosomal subunit protein uS15 Escherichia coli O139:H28 (strain E24377A / ETEC)
B5YS55 1.7e-50 156 84 0 89 3 rpsO Small ribosomal subunit protein uS15 Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X9M2 1.7e-50 156 84 0 89 3 rpsO Small ribosomal subunit protein uS15 Escherichia coli O157:H7
P66431 1.81e-50 156 83 0 89 3 rpsO Small ribosomal subunit protein uS15 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P66432 1.81e-50 156 83 0 89 3 rpsO Small ribosomal subunit protein uS15 Salmonella typhi
B4TWD4 1.81e-50 156 83 0 89 3 rpsO Small ribosomal subunit protein uS15 Salmonella schwarzengrund (strain CVM19633)
B5BGJ2 1.81e-50 156 83 0 89 3 rpsO Small ribosomal subunit protein uS15 Salmonella paratyphi A (strain AKU_12601)
C0PZ51 1.81e-50 156 83 0 89 3 rpsO Small ribosomal subunit protein uS15 Salmonella paratyphi C (strain RKS4594)
A9N729 1.81e-50 156 83 0 89 3 rpsO Small ribosomal subunit protein uS15 Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PLB3 1.81e-50 156 83 0 89 3 rpsO Small ribosomal subunit protein uS15 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T6Z5 1.81e-50 156 83 0 89 3 rpsO Small ribosomal subunit protein uS15 Salmonella newport (strain SL254)
B4TJ03 1.81e-50 156 83 0 89 3 rpsO Small ribosomal subunit protein uS15 Salmonella heidelberg (strain SL476)
B5REN3 1.81e-50 156 83 0 89 3 rpsO Small ribosomal subunit protein uS15 Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QZV5 1.81e-50 156 83 0 89 3 rpsO Small ribosomal subunit protein uS15 Salmonella enteritidis PT4 (strain P125109)
B5FI10 1.81e-50 156 83 0 89 3 rpsO Small ribosomal subunit protein uS15 Salmonella dublin (strain CT_02021853)
Q57JI2 1.81e-50 156 83 0 89 3 rpsO Small ribosomal subunit protein uS15 Salmonella choleraesuis (strain SC-B67)
B5F6T5 1.81e-50 156 83 0 89 3 rpsO Small ribosomal subunit protein uS15 Salmonella agona (strain SL483)
Q6D9A2 5.56e-50 155 84 0 89 3 rpsO Small ribosomal subunit protein uS15 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
B1JLX7 1.38e-49 154 84 0 89 3 rpsO Small ribosomal subunit protein uS15 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66F57 1.38e-49 154 84 0 89 3 rpsO Small ribosomal subunit protein uS15 Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TRI0 1.38e-49 154 84 0 89 3 rpsO Small ribosomal subunit protein uS15 Yersinia pestis (strain Pestoides F)
Q1CEL6 1.38e-49 154 84 0 89 3 rpsO Small ribosomal subunit protein uS15 Yersinia pestis bv. Antiqua (strain Nepal516)
A9R5A6 1.38e-49 154 84 0 89 3 rpsO Small ribosomal subunit protein uS15 Yersinia pestis bv. Antiqua (strain Angola)
Q8ZBC5 1.38e-49 154 84 0 89 3 rpsO Small ribosomal subunit protein uS15 Yersinia pestis
B2K2Q8 1.38e-49 154 84 0 89 3 rpsO Small ribosomal subunit protein uS15 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1CC10 1.38e-49 154 84 0 89 3 rpsO Small ribosomal subunit protein uS15 Yersinia pestis bv. Antiqua (strain Antiqua)
A7FMR9 1.38e-49 154 84 0 89 3 rpsO Small ribosomal subunit protein uS15 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
C5BFC0 1.53e-49 154 82 0 89 3 rpsO Small ribosomal subunit protein uS15 Edwardsiella ictaluri (strain 93-146)
A6TEI4 2.29e-49 153 80 0 89 3 rpsO Small ribosomal subunit protein uS15 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XSX7 3.71e-49 153 80 0 89 3 rpsO Small ribosomal subunit protein uS15 Klebsiella pneumoniae (strain 342)
A4WEY0 8.37e-49 152 80 0 89 3 rpsO Small ribosomal subunit protein uS15 Enterobacter sp. (strain 638)
A8AQ54 8.37e-49 152 80 0 89 3 rpsO Small ribosomal subunit protein uS15 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B4F2C2 1.8e-48 151 83 0 89 3 rpsO Small ribosomal subunit protein uS15 Proteus mirabilis (strain HI4320)
Q7MYY9 5.01e-48 150 80 0 89 3 rpsO Small ribosomal subunit protein uS15 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
P41120 5.29e-48 150 79 0 89 3 rpsO Small ribosomal subunit protein uS15 Photorhabdus luminescens
B2VGN5 3.2e-47 148 79 0 89 3 rpsO Small ribosomal subunit protein uS15 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q2NW20 4e-46 145 78 0 89 3 rpsO Small ribosomal subunit protein uS15 Sodalis glossinidius (strain morsitans)
A6WRG5 8.62e-46 144 77 0 89 3 rpsO Small ribosomal subunit protein uS15 Shewanella baltica (strain OS185)
B8F5Z2 6.01e-45 142 78 0 89 3 rpsO Small ribosomal subunit protein uS15 Glaesserella parasuis serovar 5 (strain SH0165)
B0BPU4 6.01e-45 142 78 0 89 3 rpsO Small ribosomal subunit protein uS15 Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3H1N7 6.01e-45 142 78 0 89 3 rpsO Small ribosomal subunit protein uS15 Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N113 6.01e-45 142 78 0 89 3 rpsO Small ribosomal subunit protein uS15 Actinobacillus pleuropneumoniae serotype 5b (strain L20)
A9KZW8 7.82e-45 142 75 0 89 3 rpsO Small ribosomal subunit protein uS15 Shewanella baltica (strain OS195)
A3D7K3 7.82e-45 142 75 0 89 3 rpsO Small ribosomal subunit protein uS15 Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8E6N5 7.82e-45 142 75 0 89 3 rpsO Small ribosomal subunit protein uS15 Shewanella baltica (strain OS223)
Q086G9 2.22e-44 141 75 0 89 3 rpsO Small ribosomal subunit protein uS15 Shewanella frigidimarina (strain NCIMB 400)
B0USL5 3.12e-44 140 78 0 89 3 rpsO Small ribosomal subunit protein uS15 Histophilus somni (strain 2336)
Q0I275 3.12e-44 140 78 0 89 3 rpsO Small ribosomal subunit protein uS15 Histophilus somni (strain 129Pt)
A6VQB6 5.52e-44 140 77 0 89 3 rpsO Small ribosomal subunit protein uS15 Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q12QH8 7.75e-44 139 75 0 89 3 rpsO Small ribosomal subunit protein uS15 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q4QKJ8 8.75e-44 139 78 0 89 3 rpsO Small ribosomal subunit protein uS15 Haemophilus influenzae (strain 86-028NP)
A1ST52 1.14e-43 139 75 0 89 3 rpsO Small ribosomal subunit protein uS15 Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
A5UC84 1.27e-43 140 78 0 89 3 rpsO Small ribosomal subunit protein uS15 Haemophilus influenzae (strain PittEE)
P44389 1.91e-43 138 78 0 89 3 rpsO1 Small ribosomal subunit protein uS15 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UEY4 1.91e-43 138 78 0 89 3 rpsO Small ribosomal subunit protein uS15 Haemophilus influenzae (strain PittGG)
Q65UQ4 2.83e-43 138 76 0 89 3 rpsO Small ribosomal subunit protein uS15 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q7VKX3 4.69e-43 137 76 0 89 3 rpsO Small ribosomal subunit protein uS15 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
C4L8X1 7.6e-43 137 75 0 89 3 rpsO Small ribosomal subunit protein uS15 Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
B8CKH6 1.06e-42 137 74 0 89 3 rpsO Small ribosomal subunit protein uS15 Shewanella piezotolerans (strain WP3 / JCM 13877)
Q1LSL1 1.23e-42 136 73 0 89 3 rpsO Small ribosomal subunit protein uS15 Baumannia cicadellinicola subsp. Homalodisca coagulata
A1RGX8 1.64e-42 136 74 0 89 3 rpsO Small ribosomal subunit protein uS15 Shewanella sp. (strain W3-18-1)
A4Y9B7 1.64e-42 136 74 0 89 3 rpsO Small ribosomal subunit protein uS15 Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A8H737 3.73e-42 135 73 0 89 3 rpsO Small ribosomal subunit protein uS15 Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B0TQ99 3.73e-42 135 73 0 89 3 rpsO Small ribosomal subunit protein uS15 Shewanella halifaxensis (strain HAW-EB4)
A0KNE0 4.26e-42 135 71 0 89 3 rpsO Small ribosomal subunit protein uS15 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q9CNX1 4.8e-42 135 76 0 89 3 rpsO Small ribosomal subunit protein uS15 Pasteurella multocida (strain Pm70)
A4SJR8 8.68e-42 134 71 0 89 3 rpsO Small ribosomal subunit protein uS15 Aeromonas salmonicida (strain A449)
B1KRQ7 9.9e-42 134 71 0 89 3 rpsO Small ribosomal subunit protein uS15 Shewanella woodyi (strain ATCC 51908 / MS32)
Q0HXR2 1.27e-41 134 73 0 89 3 rpsO Small ribosomal subunit protein uS15 Shewanella sp. (strain MR-7)
Q0HLF8 1.27e-41 134 73 0 89 3 rpsO Small ribosomal subunit protein uS15 Shewanella sp. (strain MR-4)
A0KTZ9 1.27e-41 134 73 0 89 3 rpsO Small ribosomal subunit protein uS15 Shewanella sp. (strain ANA-3)
Q8EHL3 5.55e-41 132 71 0 89 3 rpsO Small ribosomal subunit protein uS15 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A3QGU2 1.11e-40 131 71 0 89 3 rpsO Small ribosomal subunit protein uS15 Shewanella loihica (strain ATCC BAA-1088 / PV-4)
C3LSQ1 1.2e-40 131 71 0 89 3 rpsO Small ribosomal subunit protein uS15 Vibrio cholerae serotype O1 (strain M66-2)
Q9KU77 1.2e-40 131 71 0 89 3 rpsO Small ribosomal subunit protein uS15 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F929 1.2e-40 131 71 0 89 3 rpsO Small ribosomal subunit protein uS15 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
A8FYR7 1.74e-40 131 70 0 89 3 rpsO Small ribosomal subunit protein uS15 Shewanella sediminis (strain HAW-EB3)
A1S465 1.98e-40 131 70 0 89 3 rpsO Small ribosomal subunit protein uS15 Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q7MI12 2.88e-40 130 71 0 89 3 rpsO Small ribosomal subunit protein uS15 Vibrio vulnificus (strain YJ016)
Q8DBV5 2.88e-40 130 71 0 89 3 rpsO Small ribosomal subunit protein uS15 Vibrio vulnificus (strain CMCP6)
Q15V69 7.8e-40 129 68 0 89 3 rpsO Small ribosomal subunit protein uS15 Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q87M05 1.96e-39 128 69 0 89 3 rpsO Small ribosomal subunit protein uS15 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q6LUI9 3.71e-39 127 68 0 89 3 rpsO Small ribosomal subunit protein uS15 Photobacterium profundum (strain SS9)
B5FA82 4.18e-39 127 68 0 89 3 rpsO Small ribosomal subunit protein uS15 Aliivibrio fischeri (strain MJ11)
Q5E7L2 4.18e-39 127 68 0 89 3 rpsO Small ribosomal subunit protein uS15 Aliivibrio fischeri (strain ATCC 700601 / ES114)
B6ENE5 2.03e-38 125 67 0 89 3 rpsO Small ribosomal subunit protein uS15 Aliivibrio salmonicida (strain LFI1238)
Q5QTZ1 2.29e-38 125 67 0 89 3 rpsO Small ribosomal subunit protein uS15 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
B7VJH4 6.93e-38 124 67 0 89 3 rpsO Small ribosomal subunit protein uS15 Vibrio atlanticus (strain LGP32)
B4RXU2 1.88e-37 123 67 0 89 3 rpsO Small ribosomal subunit protein uS15 Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
Q1QSZ3 4.28e-37 122 65 0 89 3 rpsO Small ribosomal subunit protein uS15 Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q6FF13 6.79e-37 122 67 0 89 3 rpsO Small ribosomal subunit protein uS15 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
B0VEA4 5.34e-36 120 66 0 89 3 rpsO Small ribosomal subunit protein uS15 Acinetobacter baumannii (strain AYE)
A3M1M6 5.34e-36 120 66 0 89 3 rpsO Small ribosomal subunit protein uS15 Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0VLR8 5.34e-36 120 66 0 89 3 rpsO Small ribosomal subunit protein uS15 Acinetobacter baumannii (strain SDF)
B2I2P9 5.34e-36 120 66 0 89 3 rpsO Small ribosomal subunit protein uS15 Acinetobacter baumannii (strain ACICU)
B7I3U0 5.34e-36 120 66 0 89 1 rpsO Small ribosomal subunit protein uS15 Acinetobacter baumannii (strain AB0057)
B7H0Z2 5.34e-36 120 66 0 89 3 rpsO Small ribosomal subunit protein uS15 Acinetobacter baumannii (strain AB307-0294)
Q21H64 7.75e-36 119 64 0 89 3 rpsO Small ribosomal subunit protein uS15 Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q482T6 8.93e-36 119 65 0 89 3 rpsO Small ribosomal subunit protein uS15 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q4KIF3 9.44e-36 119 65 0 89 3 rpsO Small ribosomal subunit protein uS15 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
C4K3E7 1.03e-35 119 62 0 89 3 rpsO Small ribosomal subunit protein uS15 Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
Q1GXD3 1.4e-35 119 61 0 89 3 rpsO Small ribosomal subunit protein uS15 Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q0VSR8 1.9e-35 118 64 0 89 3 rpsO Small ribosomal subunit protein uS15 Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
B1J2B2 2.08e-35 118 65 0 89 3 rpsO Small ribosomal subunit protein uS15 Pseudomonas putida (strain W619)
B0KHX5 2.08e-35 118 65 0 89 3 rpsO Small ribosomal subunit protein uS15 Pseudomonas putida (strain GB-1)
Q4ZNR5 2.15e-35 118 64 0 89 3 rpsO Small ribosomal subunit protein uS15 Pseudomonas syringae pv. syringae (strain B728a)
Q87WQ7 2.15e-35 118 64 0 89 3 rpsO Small ribosomal subunit protein uS15 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q48E80 2.15e-35 118 64 0 89 3 rpsO Small ribosomal subunit protein uS15 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q0A7A0 2.29e-35 118 64 0 89 3 rpsO Small ribosomal subunit protein uS15 Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q1IF40 2.62e-35 118 64 0 89 3 rpsO Small ribosomal subunit protein uS15 Pseudomonas entomophila (strain L48)
Q3KI81 2.95e-35 118 62 0 89 3 rpsO Small ribosomal subunit protein uS15 Pseudomonas fluorescens (strain Pf0-1)
Q88DV9 4.68e-35 117 64 0 89 3 rpsO Small ribosomal subunit protein uS15 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5W984 4.68e-35 117 64 0 89 3 rpsO Small ribosomal subunit protein uS15 Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
A4XYD7 4.89e-35 117 64 0 89 3 rpsO Small ribosomal subunit protein uS15 Pseudomonas mendocina (strain ymp)
Q3IJ74 5.64e-35 117 64 0 89 3 rpsO Small ribosomal subunit protein uS15 Pseudoalteromonas translucida (strain TAC 125)
A6VU32 5.7e-35 117 65 0 89 3 rpsO Small ribosomal subunit protein uS15 Marinomonas sp. (strain MWYL1)
C5BPV6 9.86e-35 116 62 0 89 3 rpsO Small ribosomal subunit protein uS15 Teredinibacter turnerae (strain ATCC 39867 / T7901)
A1K7B6 1.09e-34 116 61 0 89 3 rpsO Small ribosomal subunit protein uS15 Azoarcus sp. (strain BH72)
Q9HV58 1.24e-34 116 62 0 89 1 rpsO Small ribosomal subunit protein uS15 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02FT1 1.24e-34 116 62 0 89 3 rpsO Small ribosomal subunit protein uS15 Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V1F3 1.24e-34 116 62 0 89 3 rpsO Small ribosomal subunit protein uS15 Pseudomonas aeruginosa (strain LESB58)
A6VCJ8 1.24e-34 116 62 0 89 3 rpsO Small ribosomal subunit protein uS15 Pseudomonas aeruginosa (strain PA7)
A1WXU8 1.27e-34 116 61 0 89 3 rpsO Small ribosomal subunit protein uS15 Halorhodospira halophila (strain DSM 244 / SL1)
Q47D97 4.19e-34 115 61 0 89 3 rpsO Small ribosomal subunit protein uS15 Dechloromonas aromatica (strain RCB)
C1D8W9 4.29e-34 115 61 0 89 3 rpsO Small ribosomal subunit protein uS15 Laribacter hongkongensis (strain HLHK9)
Q5NZR8 4.58e-34 115 61 0 89 3 rpsO Small ribosomal subunit protein uS15 Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
A1U5Z7 6.58e-34 114 61 0 89 3 rpsO Small ribosomal subunit protein uS15 Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
A4VPN7 6.8e-34 114 62 0 89 3 rpsO Small ribosomal subunit protein uS15 Stutzerimonas stutzeri (strain A1501)
A5WBT1 1e-33 114 63 0 87 3 rpsO Small ribosomal subunit protein uS15 Psychrobacter sp. (strain PRwf-1)
C3K256 1.03e-33 114 62 0 89 3 rpsO Small ribosomal subunit protein uS15 Pseudomonas fluorescens (strain SBW25)
Q18BI0 1.32e-33 114 64 0 81 3 rpsO Small ribosomal subunit protein uS15 Clostridioides difficile (strain 630)
Q8K9H4 1.34e-33 114 58 0 89 3 rpsO Small ribosomal subunit protein uS15 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
A9IGJ8 1.43e-33 114 61 0 89 3 rpsO Small ribosomal subunit protein uS15 Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
B2U7R7 1.78e-33 113 61 0 89 3 rpsO Small ribosomal subunit protein uS15 Ralstonia pickettii (strain 12J)
C1DFK6 2.01e-33 113 61 0 89 3 rpsO Small ribosomal subunit protein uS15 Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q2KWI4 2.37e-33 113 60 0 89 3 rpsO Small ribosomal subunit protein uS15 Bordetella avium (strain 197N)
B8GP05 2.48e-33 113 61 0 89 3 rpsO Small ribosomal subunit protein uS15 Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q7VZU1 2.73e-33 113 60 0 89 3 rpsO Small ribosomal subunit protein uS15 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W569 2.73e-33 113 60 0 89 3 rpsO Small ribosomal subunit protein uS15 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WCP9 2.73e-33 113 60 0 89 3 rpsO Small ribosomal subunit protein uS15 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
C0ZF45 4.89e-33 112 59 0 89 3 rpsO Small ribosomal subunit protein uS15 Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
Q3SKX4 6.02e-33 112 59 0 89 3 rpsO Small ribosomal subunit protein uS15 Thiobacillus denitrificans (strain ATCC 25259)
P05766 7.1e-33 112 60 0 89 1 rpsO Small ribosomal subunit protein uS15 Geobacillus stearothermophilus
Q2Y5X8 1.04e-32 111 58 0 89 3 rpsO Small ribosomal subunit protein uS15 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
B8D7R1 1.21e-32 111 58 0 89 3 rpsO Small ribosomal subunit protein uS15 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57455 1.21e-32 111 58 0 89 3 rpsO Small ribosomal subunit protein uS15 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D9F9 1.21e-32 111 58 0 89 3 rpsO Small ribosomal subunit protein uS15 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
Q2SZP0 1.34e-32 111 60 0 89 3 rpsO Small ribosomal subunit protein uS15 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63VN8 1.34e-32 111 60 0 89 3 rpsO Small ribosomal subunit protein uS15 Burkholderia pseudomallei (strain K96243)
A3N7L2 1.34e-32 111 60 0 89 3 rpsO Small ribosomal subunit protein uS15 Burkholderia pseudomallei (strain 668)
Q3JUB4 1.34e-32 111 60 0 89 3 rpsO Small ribosomal subunit protein uS15 Burkholderia pseudomallei (strain 1710b)
A3NTA0 1.34e-32 111 60 0 89 3 rpsO Small ribosomal subunit protein uS15 Burkholderia pseudomallei (strain 1106a)
A1V2L1 1.34e-32 111 60 0 89 3 rpsO Small ribosomal subunit protein uS15 Burkholderia mallei (strain SAVP1)
Q62IN0 1.34e-32 111 60 0 89 3 rpsO Small ribosomal subunit protein uS15 Burkholderia mallei (strain ATCC 23344)
A2S464 1.34e-32 111 60 0 89 3 rpsO Small ribosomal subunit protein uS15 Burkholderia mallei (strain NCTC 10229)
A3MI96 1.34e-32 111 60 0 89 3 rpsO Small ribosomal subunit protein uS15 Burkholderia mallei (strain NCTC 10247)
C5D9D4 1.43e-32 111 60 0 89 3 rpsO Small ribosomal subunit protein uS15 Geobacillus sp. (strain WCH70)
Q493T4 1.6e-32 111 59 0 88 3 rpsO Small ribosomal subunit protein uS15 Blochmanniella pennsylvanica (strain BPEN)
B3PI99 1.63e-32 111 60 0 89 3 rpsO Small ribosomal subunit protein uS15 Cellvibrio japonicus (strain Ueda107)
Q9KA82 2.15e-32 110 58 0 89 3 rpsO Small ribosomal subunit protein uS15 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
A4JGD5 3.56e-32 110 60 0 89 3 rpsO Small ribosomal subunit protein uS15 Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q1BV08 3.56e-32 110 60 0 89 3 rpsO Small ribosomal subunit protein uS15 Burkholderia orbicola (strain AU 1054)
B1JVP6 3.56e-32 110 60 0 89 3 rpsO Small ribosomal subunit protein uS15 Burkholderia orbicola (strain MC0-3)
A9AJN9 3.56e-32 110 60 0 89 3 rpsO Small ribosomal subunit protein uS15 Burkholderia multivorans (strain ATCC 17616 / 249)
Q39EE0 3.56e-32 110 60 0 89 3 rpsO Small ribosomal subunit protein uS15 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q0BDC5 3.56e-32 110 60 0 89 3 rpsO Small ribosomal subunit protein uS15 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B4E5M7 3.56e-32 110 60 0 89 3 rpsO Small ribosomal subunit protein uS15 Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A0K928 3.56e-32 110 60 0 89 3 rpsO Small ribosomal subunit protein uS15 Burkholderia cenocepacia (strain HI2424)
B1YTR2 3.56e-32 110 60 0 89 3 rpsO Small ribosomal subunit protein uS15 Burkholderia ambifaria (strain MC40-6)
A4IME2 3.68e-32 110 59 0 89 3 rpsO Small ribosomal subunit protein uS15 Geobacillus thermodenitrificans (strain NG80-2)
Q4FVL1 4.5e-32 110 60 0 87 3 rpsO Small ribosomal subunit protein uS15 Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q5L0I3 4.58e-32 110 58 0 89 3 rpsO Small ribosomal subunit protein uS15 Geobacillus kaustophilus (strain HTA426)
Q5LLT1 4.63e-32 110 58 0 89 3 rpsO Small ribosomal subunit protein uS15 Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q83D88 7.25e-32 109 61 0 88 3 rpsO Small ribosomal subunit protein uS15 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9ND63 7.25e-32 109 61 0 88 3 rpsO Small ribosomal subunit protein uS15 Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KFK5 7.25e-32 109 61 0 88 3 rpsO Small ribosomal subunit protein uS15 Coxiella burnetii (strain Dugway 5J108-111)
B6J6S6 7.25e-32 109 61 0 88 3 rpsO Small ribosomal subunit protein uS15 Coxiella burnetii (strain CbuK_Q154)
B1Y822 7.56e-32 109 64 0 81 3 rpsO Small ribosomal subunit protein uS15 Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
Q7NY11 8.55e-32 109 59 0 89 3 rpsO Small ribosomal subunit protein uS15 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
A4SXQ8 8.64e-32 109 58 0 89 3 rpsO Small ribosomal subunit protein uS15 Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
A1TLL1 9.17e-32 109 57 0 87 3 rpsO Small ribosomal subunit protein uS15 Paracidovorax citrulli (strain AAC00-1)
Q142H8 9.4e-32 109 59 0 88 3 rpsO Small ribosomal subunit protein uS15 Paraburkholderia xenovorans (strain LB400)
A4G648 9.64e-32 109 59 0 89 3 rpsO Small ribosomal subunit protein uS15 Herminiimonas arsenicoxydans
Q1QEP0 1.1e-31 108 60 0 87 3 rpsO Small ribosomal subunit protein uS15 Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q5WFU7 1.14e-31 108 57 0 89 3 rpsO Small ribosomal subunit protein uS15 Shouchella clausii (strain KSM-K16)
A4WWP1 1.48e-31 108 57 0 89 3 rpsO Small ribosomal subunit protein uS15 Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
C4L6J5 1.82e-31 108 57 0 89 3 rpsO Small ribosomal subunit protein uS15 Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
A7IC04 1.86e-31 108 56 0 89 3 rpsO Small ribosomal subunit protein uS15 Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
B2JDN3 2.56e-31 108 59 0 89 3 rpsO Small ribosomal subunit protein uS15 Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q0AK63 2.92e-31 108 56 0 89 3 rpsO Small ribosomal subunit protein uS15 Maricaulis maris (strain MCS10)
Q3IYT8 2.92e-31 108 57 0 89 3 rpsO Small ribosomal subunit protein uS15 Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A3PNF9 2.92e-31 108 57 0 89 3 rpsO Small ribosomal subunit protein uS15 Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
C3MC70 3.02e-31 107 57 0 89 3 rpsO Small ribosomal subunit protein uS15 Sinorhizobium fredii (strain NBRC 101917 / NGR234)
A9BNB9 3.34e-31 107 57 0 87 3 rpsO Small ribosomal subunit protein uS15 Delftia acidovorans (strain DSM 14801 / SPH-1)
C5CT25 3.42e-31 107 58 0 87 3 rpsO Small ribosomal subunit protein uS15 Variovorax paradoxus (strain S110)
Q82XS9 3.84e-31 107 56 0 89 3 rpsO Small ribosomal subunit protein uS15 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
A1SLJ5 5.35e-31 107 58 1 91 3 rpsO Small ribosomal subunit protein uS15 Nocardioides sp. (strain ATCC BAA-499 / JS614)
Q8XXP4 5.76e-31 107 57 0 89 3 rpsO Small ribosomal subunit protein uS15 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
A1W4L7 6.04e-31 107 57 0 87 3 rpsO Small ribosomal subunit protein uS15 Acidovorax sp. (strain JS42)
B9MEK9 6.04e-31 107 57 0 87 3 rpsO Small ribosomal subunit protein uS15 Acidovorax ebreus (strain TPSY)
B1XUJ4 6.42e-31 107 57 0 89 3 rpsO Small ribosomal subunit protein uS15 Polynucleobacter necessarius subsp. necessarius (strain STIR1)
Q2SML0 6.5e-31 107 59 0 89 3 rpsO Small ribosomal subunit protein uS15 Hahella chejuensis (strain KCTC 2396)
Q0AE54 7.01e-31 107 55 0 89 3 rpsO Small ribosomal subunit protein uS15 Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
B2FN87 7.93e-31 106 59 1 89 3 rpsO Small ribosomal subunit protein uS15 Stenotrophomonas maltophilia (strain K279a)
B4SQR7 7.93e-31 106 59 1 89 3 rpsO Small ribosomal subunit protein uS15 Stenotrophomonas maltophilia (strain R551-3)
Q2NBZ3 8.18e-31 107 53 0 89 3 rpsO Small ribosomal subunit protein uS15 Erythrobacter litoralis (strain HTCC2594)
B3EAF1 9.79e-31 106 57 0 87 3 rpsO Small ribosomal subunit protein uS15 Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
Q5GXV2 1.04e-30 106 63 0 82 3 rpsO Small ribosomal subunit protein uS15 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SVK0 1.04e-30 106 63 0 82 3 rpsO Small ribosomal subunit protein uS15 Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2P0X4 1.04e-30 106 63 0 82 3 rpsO Small ribosomal subunit protein uS15 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q3BRP8 1.04e-30 106 63 0 82 3 rpsO Small ribosomal subunit protein uS15 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8PJ58 1.04e-30 106 63 0 82 3 rpsO Small ribosomal subunit protein uS15 Xanthomonas axonopodis pv. citri (strain 306)
A1AMM5 1.05e-30 106 57 0 87 3 rpsO Small ribosomal subunit protein uS15 Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
Q11BC4 1.09e-30 106 55 0 89 3 rpsO Small ribosomal subunit protein uS15 Chelativorans sp. (strain BNC1)
Q89AF7 1.09e-30 106 57 0 89 3 rpsO Small ribosomal subunit protein uS15 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
B0TZ10 1.19e-30 106 58 0 87 3 rpsO Small ribosomal subunit protein uS15 Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
A6SY01 1.4e-30 106 58 0 89 3 rpsO Small ribosomal subunit protein uS15 Janthinobacterium sp. (strain Marseille)
Q39VA2 1.57e-30 106 57 0 87 3 rpsO Small ribosomal subunit protein uS15 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q92SW1 1.72e-30 105 56 0 89 3 rpsO Small ribosomal subunit protein uS15 Rhizobium meliloti (strain 1021)
Q8P7V0 1.73e-30 105 63 0 82 3 rpsO Small ribosomal subunit protein uS15 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RRB7 1.73e-30 105 63 0 82 3 rpsO Small ribosomal subunit protein uS15 Xanthomonas campestris pv. campestris (strain B100)
Q4UW99 1.73e-30 105 63 0 82 3 rpsO Small ribosomal subunit protein uS15 Xanthomonas campestris pv. campestris (strain 8004)
A6UF33 1.76e-30 105 56 0 89 3 rpsO Small ribosomal subunit protein uS15 Sinorhizobium medicae (strain WSM419)
A4IZA7 1.95e-30 105 58 0 87 3 rpsO Small ribosomal subunit protein uS15 Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NGX8 1.95e-30 105 58 0 87 3 rpsO Small ribosomal subunit protein uS15 Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
B2SDK9 1.95e-30 105 58 0 87 3 rpsO Small ribosomal subunit protein uS15 Francisella tularensis subsp. mediasiatica (strain FSC147)
Q14ID0 1.95e-30 105 58 0 87 3 rpsO Small ribosomal subunit protein uS15 Francisella tularensis subsp. tularensis (strain FSC 198)
Q8RHN4 2.63e-30 105 59 0 81 3 rpsO Small ribosomal subunit protein uS15 Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q0AYI3 2.7e-30 105 59 0 89 3 rpsO Small ribosomal subunit protein uS15 Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
Q65JH6 2.7e-30 105 55 0 89 3 rpsO Small ribosomal subunit protein uS15 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
B0UEX4 3.63e-30 105 55 0 89 3 rpsO Small ribosomal subunit protein uS15 Methylobacterium sp. (strain 4-46)
Q609C5 3.79e-30 105 57 0 89 3 rpsO Small ribosomal subunit protein uS15 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
A1WLP9 3.85e-30 105 57 0 87 3 rpsO Small ribosomal subunit protein uS15 Verminephrobacter eiseniae (strain EF01-2)
Q3ABA4 3.96e-30 105 57 0 89 3 rpsO Small ribosomal subunit protein uS15 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
B8IGX2 4.09e-30 105 56 0 89 3 rpsO Small ribosomal subunit protein uS15 Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
Q3J9B9 4.47e-30 105 56 0 89 3 rpsO Small ribosomal subunit protein uS15 Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
A0Q5I8 4.59e-30 105 58 0 87 3 rpsO Small ribosomal subunit protein uS15 Francisella tularensis subsp. novicida (strain U112)
B1YI58 5.75e-30 104 56 0 89 3 rpsO Small ribosomal subunit protein uS15 Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
Q1GKK2 6.42e-30 104 55 0 89 3 rpsO Small ribosomal subunit protein uS15 Ruegeria sp. (strain TM1040)
Q6MMS3 6.63e-30 104 55 0 89 3 rpsO Small ribosomal subunit protein uS15 Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
A1VG87 7.16e-30 104 55 0 89 3 rpsO Small ribosomal subunit protein uS15 Nitratidesulfovibrio vulgaris (strain DP4)
Q72ER5 7.16e-30 104 55 0 89 3 rpsO Small ribosomal subunit protein uS15 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
B0T174 7.16e-30 104 55 0 89 3 rpsO Small ribosomal subunit protein uS15 Caulobacter sp. (strain K31)
Q0BKU0 9.88e-30 103 57 0 87 3 rpsO Small ribosomal subunit protein uS15 Francisella tularensis subsp. holarctica (strain OSU18)
Q2A268 9.88e-30 103 57 0 87 3 rpsO Small ribosomal subunit protein uS15 Francisella tularensis subsp. holarctica (strain LVS)
A7NDP4 9.88e-30 103 57 0 87 3 rpsO Small ribosomal subunit protein uS15 Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
A9VT45 1.05e-29 103 57 0 89 3 rpsO Small ribosomal subunit protein uS15 Bacillus mycoides (strain KBAB4)
Q6HF07 1.05e-29 103 57 0 89 3 rpsO Small ribosomal subunit protein uS15 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q636L8 1.05e-29 103 57 0 89 3 rpsO Small ribosomal subunit protein uS15 Bacillus cereus (strain ZK / E33L)
Q819Z0 1.05e-29 103 57 0 89 3 rpsO Small ribosomal subunit protein uS15 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
A7GRD8 1.05e-29 103 57 0 89 3 rpsO Small ribosomal subunit protein uS15 Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
B7HLE1 1.05e-29 103 57 0 89 3 rpsO Small ribosomal subunit protein uS15 Bacillus cereus (strain AH187)
B7HDT1 1.05e-29 103 57 0 89 3 rpsO Small ribosomal subunit protein uS15 Bacillus cereus (strain B4264)
C1EP30 1.05e-29 103 57 0 89 3 rpsO Small ribosomal subunit protein uS15 Bacillus cereus (strain 03BB102)
B7IUG6 1.05e-29 103 57 0 89 3 rpsO Small ribosomal subunit protein uS15 Bacillus cereus (strain G9842)
Q732R4 1.05e-29 103 57 0 89 3 rpsO Small ribosomal subunit protein uS15 Bacillus cereus (strain ATCC 10987 / NRS 248)
B7JJ85 1.05e-29 103 57 0 89 3 rpsO Small ribosomal subunit protein uS15 Bacillus cereus (strain AH820)
Q81WM7 1.05e-29 103 57 0 89 3 rpsO Small ribosomal subunit protein uS15 Bacillus anthracis
A0RHH9 1.05e-29 103 57 0 89 3 rpsO Small ribosomal subunit protein uS15 Bacillus thuringiensis (strain Al Hakam)
C3L7B9 1.05e-29 103 57 0 89 3 rpsO Small ribosomal subunit protein uS15 Bacillus anthracis (strain CDC 684 / NRRL 3495)
Q2RJM0 1.12e-29 103 57 0 89 3 rpsO Small ribosomal subunit protein uS15 Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
A8FDD6 1.31e-29 103 53 0 89 3 rpsO Small ribosomal subunit protein uS15 Bacillus pumilus (strain SAFR-032)
B7GG70 1.34e-29 103 55 0 89 3 rpsO Small ribosomal subunit protein uS15 Anoxybacillus flavithermus (strain DSM 21510 / WK1)
A7Z4T9 1.4e-29 103 53 0 89 3 rpsO Small ribosomal subunit protein uS15 Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q5FQM0 1.41e-29 103 56 0 89 3 rpsO Small ribosomal subunit protein uS15 Gluconobacter oxydans (strain 621H)
Q21YD2 1.55e-29 103 56 0 87 3 rpsO Small ribosomal subunit protein uS15 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q28K15 1.7e-29 103 55 0 89 3 rpsO Small ribosomal subunit protein uS15 Jannaschia sp. (strain CCS1)
A5GF90 1.71e-29 103 56 0 87 3 rpsO Small ribosomal subunit protein uS15 Geotalea uraniireducens (strain Rf4)
B5YHN1 1.72e-29 103 55 0 89 3 rpsO Small ribosomal subunit protein uS15 Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
A9W8P9 1.96e-29 103 53 0 89 3 rpsO Small ribosomal subunit protein uS15 Methylorubrum extorquens (strain PA1)
B7KN56 1.96e-29 103 53 0 89 3 rpsO Small ribosomal subunit protein uS15 Methylorubrum extorquens (strain CM4 / NCIMB 13688)
Q8UJ54 1.96e-29 103 53 0 89 3 rpsO Small ribosomal subunit protein uS15 Agrobacterium fabrum (strain C58 / ATCC 33970)
A0LHM3 2.5e-29 103 55 0 89 3 rpsO Small ribosomal subunit protein uS15 Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
P21473 2.88e-29 102 53 0 89 1 rpsO Small ribosomal subunit protein uS15 Bacillus subtilis (strain 168)
C6C0C8 2.94e-29 102 53 0 89 3 rpsO Small ribosomal subunit protein uS15 Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
A5EXU1 3.23e-29 102 56 0 87 3 rpsO Small ribosomal subunit protein uS15 Dichelobacter nodosus (strain VCS1703A)
A4J5W7 3.36e-29 102 57 0 89 3 rpsO Small ribosomal subunit protein uS15 Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
B0THS1 3.51e-29 102 56 0 88 3 rpsO Small ribosomal subunit protein uS15 Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
B9M1G4 3.56e-29 102 56 0 87 3 rpsO Small ribosomal subunit protein uS15 Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
A8LKE4 3.79e-29 102 56 0 89 3 rpsO Small ribosomal subunit protein uS15 Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
Q2KDZ9 3.91e-29 102 52 0 89 3 rpsO Small ribosomal subunit protein uS15 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
B3PXD9 3.91e-29 102 52 0 89 3 rpsO Small ribosomal subunit protein uS15 Rhizobium etli (strain CIAT 652)
A0AID1 4.23e-29 102 55 0 89 3 rpsO Small ribosomal subunit protein uS15 Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q92C24 4.23e-29 102 55 0 89 1 rpsO Small ribosomal subunit protein uS15 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
B8DFZ7 4.23e-29 102 55 0 89 3 rpsO Small ribosomal subunit protein uS15 Listeria monocytogenes serotype 4a (strain HCC23)
Q71ZZ2 4.23e-29 102 55 0 89 3 rpsO Small ribosomal subunit protein uS15 Listeria monocytogenes serotype 4b (strain F2365)
C1L2N6 4.23e-29 102 55 0 89 3 rpsO Small ribosomal subunit protein uS15 Listeria monocytogenes serotype 4b (strain CLIP80459)
Q7ANZ1 4.23e-29 102 55 0 89 3 rpsO Small ribosomal subunit protein uS15 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
B8GWZ1 4.51e-29 102 53 0 89 3 rpsO Small ribosomal subunit protein uS15 Caulobacter vibrioides (strain NA1000 / CB15N)
Q9AC31 4.51e-29 102 53 0 89 3 rpsO Small ribosomal subunit protein uS15 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q16CF2 4.56e-29 102 55 0 89 3 rpsO Small ribosomal subunit protein uS15 Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q98BI4 5.44e-29 102 52 0 89 3 rpsO Small ribosomal subunit protein uS15 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q8RA42 6.3e-29 102 58 0 87 3 rpsO Small ribosomal subunit protein uS15 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
B9JGT0 6.7e-29 102 52 0 89 3 rpsO Small ribosomal subunit protein uS15 Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
B8FCY9 6.84e-29 102 52 0 89 3 rpsO Small ribosomal subunit protein uS15 Desulfatibacillum aliphaticivorans
Q24UJ1 7.76e-29 102 58 0 87 3 rpsO Small ribosomal subunit protein uS15 Desulfitobacterium hafniense (strain Y51)
A5VCY8 8.07e-29 101 53 0 89 3 rpsO Small ribosomal subunit protein uS15 Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
Q2LWU2 8.37e-29 101 55 0 87 3 rpsO Small ribosomal subunit protein uS15 Syntrophus aciditrophicus (strain SB)
B1ZGS8 1.02e-28 101 52 0 89 3 rpsO Small ribosomal subunit protein uS15 Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
B5ZW25 1.12e-28 101 51 0 89 3 rpsO Small ribosomal subunit protein uS15 Rhizobium leguminosarum bv. trifolii (strain WSM2304)
B9DTE2 1.22e-28 101 51 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus uberis (strain ATCC BAA-854 / 0140J)
B1ZS99 1.24e-28 101 55 0 86 3 rpsO Small ribosomal subunit protein uS15 Opitutus terrae (strain DSM 11246 / JCM 15787 / PB90-1)
A0LE15 1.29e-28 101 50 0 89 3 rpsO Small ribosomal subunit protein uS15 Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
A1B5Q0 1.32e-28 101 53 0 89 3 rpsO Small ribosomal subunit protein uS15 Paracoccus denitrificans (strain Pd 1222)
B3R3W1 1.34e-28 101 52 0 89 3 rpsO Small ribosomal subunit protein uS15 Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q0KCT5 1.34e-28 101 52 0 89 3 rpsO Small ribosomal subunit protein uS15 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q1LPW9 1.34e-28 101 55 0 89 3 rpsO Small ribosomal subunit protein uS15 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
A6TRK2 1.38e-28 101 62 0 79 3 rpsO Small ribosomal subunit protein uS15 Alkaliphilus metalliredigens (strain QYMF)
Q473U8 1.52e-28 101 52 0 89 3 rpsO Small ribosomal subunit protein uS15 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q1MN43 1.56e-28 101 51 0 89 3 rpsO Small ribosomal subunit protein uS15 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q74CT0 1.62e-28 100 57 0 87 3 rpsO Small ribosomal subunit protein uS15 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
B1KWK2 1.77e-28 100 61 0 80 3 rpsO Small ribosomal subunit protein uS15 Clostridium botulinum (strain Loch Maree / Type A3)
A7GG01 1.77e-28 100 61 0 80 3 rpsO Small ribosomal subunit protein uS15 Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
B1II44 1.77e-28 100 61 0 80 3 rpsO Small ribosomal subunit protein uS15 Clostridium botulinum (strain Okra / Type B1)
A5I4I8 1.77e-28 100 61 0 80 3 rpsO Small ribosomal subunit protein uS15 Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FVY8 1.77e-28 100 61 0 80 3 rpsO Small ribosomal subunit protein uS15 Clostridium botulinum (strain ATCC 19397 / Type A)
Q127W7 1.78e-28 100 60 0 81 3 rpsO Small ribosomal subunit protein uS15 Polaromonas sp. (strain JS666 / ATCC BAA-500)
B2TJ60 1.91e-28 100 61 0 80 3 rpsO Small ribosomal subunit protein uS15 Clostridium botulinum (strain Eklund 17B / Type B)
A9KNL0 1.95e-28 100 56 0 87 3 rpsO Small ribosomal subunit protein uS15 Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
A7HZ96 2.07e-28 100 52 0 89 3 rpsO Small ribosomal subunit protein uS15 Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
B9DPD9 2.09e-28 100 53 0 89 3 rpsO Small ribosomal subunit protein uS15 Staphylococcus carnosus (strain TM300)
B0K1D1 2.13e-28 100 56 0 87 3 rpsO Small ribosomal subunit protein uS15 Thermoanaerobacter sp. (strain X514)
B0K9P5 2.13e-28 100 56 0 87 3 rpsO Small ribosomal subunit protein uS15 Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
B8DN08 2.39e-28 100 55 0 89 3 rpsO Small ribosomal subunit protein uS15 Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
B2V4H4 2.44e-28 100 61 0 80 3 rpsO Small ribosomal subunit protein uS15 Clostridium botulinum (strain Alaska E43 / Type E3)
A1A007 2.49e-28 100 56 0 89 3 rpsO Small ribosomal subunit protein uS15 Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a)
A1VM55 2.68e-28 100 55 0 87 3 rpsO Small ribosomal subunit protein uS15 Polaromonas naphthalenivorans (strain CJ2)
B1LZQ2 2.78e-28 100 52 0 89 3 rpsO Small ribosomal subunit protein uS15 Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
Q1DAM2 2.91e-28 100 55 0 89 3 rpsO Small ribosomal subunit protein uS15 Myxococcus xanthus (strain DK1622)
Q30WI6 2.97e-28 100 49 0 89 3 rpsO Small ribosomal subunit protein uS15 Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q8EQT8 3.17e-28 100 52 0 89 3 rpsO Small ribosomal subunit protein uS15 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
A0Q0Q2 4.26e-28 100 58 0 80 3 rpsO Small ribosomal subunit protein uS15 Clostridium novyi (strain NT)
A8MFB3 4.91e-28 99 58 0 84 3 rpsO Small ribosomal subunit protein uS15 Alkaliphilus oremlandii (strain OhILAs)
Q3A4A2 5.05e-28 99 55 0 87 3 rpsO Small ribosomal subunit protein uS15 Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
B8EP10 5.31e-28 99 51 0 89 3 rpsO Small ribosomal subunit protein uS15 Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
Q0BPK2 5.61e-28 99 53 0 89 3 rpsO Small ribosomal subunit protein uS15 Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
B0SQH7 7.33e-28 99 54 0 87 3 rpsO Small ribosomal subunit protein uS15 Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris)
B0SH21 7.33e-28 99 54 0 87 3 rpsO Small ribosomal subunit protein uS15 Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames)
B4RC49 8.69e-28 99 52 0 89 3 rpsO Small ribosomal subunit protein uS15 Phenylobacterium zucineum (strain HLK1)
B8DVV7 9.39e-28 99 57 0 89 3 rpsO Small ribosomal subunit protein uS15 Bifidobacterium animalis subsp. lactis (strain AD011)
C0MFA8 9.49e-28 99 50 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus equi subsp. zooepidemicus (strain H70)
Q1J4M6 9.49e-28 99 50 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus pyogenes serotype M4 (strain MGAS10750)
B4U574 9.49e-28 99 50 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
C0M9D9 9.49e-28 99 50 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus equi subsp. equi (strain 4047)
A4XL65 1.16e-27 99 56 0 87 3 rpsO Small ribosomal subunit protein uS15 Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
B5EMD3 1.19e-27 99 55 0 89 3 rpsO Small ribosomal subunit protein uS15 Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J4D7 1.19e-27 99 55 0 89 3 rpsO Small ribosomal subunit protein uS15 Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
B5XIK9 1.25e-27 99 50 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus pyogenes serotype M49 (strain NZ131)
P0DE75 1.25e-27 99 50 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus pyogenes serotype M3 (strain SSI-1)
Q48R96 1.25e-27 99 50 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus pyogenes serotype M28 (strain MGAS6180)
A2RGH7 1.25e-27 99 50 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1JEW0 1.25e-27 99 50 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JJW9 1.25e-27 99 50 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1J9S0 1.25e-27 99 50 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q7CMR3 1.25e-27 99 50 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5X9V4 1.25e-27 99 50 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DE74 1.25e-27 99 50 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q5X1C6 1.25e-27 99 52 0 88 3 rpsO Small ribosomal subunit protein uS15 Legionella pneumophila (strain Paris)
Q7A116 1.39e-27 98 52 0 89 3 rpsO Small ribosomal subunit protein uS15 Staphylococcus aureus (strain MW2)
A8Z3V3 1.39e-27 98 52 0 89 3 rpsO Small ribosomal subunit protein uS15 Staphylococcus aureus (strain USA300 / TCH1516)
Q6G9U0 1.39e-27 98 52 0 89 3 rpsO Small ribosomal subunit protein uS15 Staphylococcus aureus (strain MSSA476)
Q6GHG2 1.39e-27 98 52 0 89 3 rpsO Small ribosomal subunit protein uS15 Staphylococcus aureus (strain MRSA252)
Q7A5X8 1.39e-27 98 52 0 89 1 rpsO Small ribosomal subunit protein uS15 Staphylococcus aureus (strain N315)
Q99UJ9 1.39e-27 98 52 0 89 3 rpsO Small ribosomal subunit protein uS15 Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QGH2 1.39e-27 98 52 0 89 3 rpsO Small ribosomal subunit protein uS15 Staphylococcus aureus (strain Newman)
Q5HGF8 1.39e-27 98 52 0 89 3 rpsO Small ribosomal subunit protein uS15 Staphylococcus aureus (strain COL)
Q2YXP3 1.39e-27 98 52 0 89 1 rpsO Small ribosomal subunit protein uS15 Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5ISF7 1.39e-27 98 52 0 89 3 rpsO Small ribosomal subunit protein uS15 Staphylococcus aureus (strain JH9)
Q2G2Q1 1.39e-27 98 52 0 89 1 rpsO Small ribosomal subunit protein uS15 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FHG5 1.39e-27 98 52 0 89 3 rpsO Small ribosomal subunit protein uS15 Staphylococcus aureus (strain USA300)
A6U192 1.39e-27 98 52 0 89 3 rpsO Small ribosomal subunit protein uS15 Staphylococcus aureus (strain JH1)
A7X1Q7 1.39e-27 98 52 0 89 3 rpsO Small ribosomal subunit protein uS15 Staphylococcus aureus (strain Mu3 / ATCC 700698)
A8IGA5 1.41e-27 98 50 0 89 3 rpsO Small ribosomal subunit protein uS15 Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
C0QHM5 1.42e-27 98 55 0 89 3 rpsO Small ribosomal subunit protein uS15 Desulforapulum autotrophicum (strain ATCC 43914 / DSM 3382 / VKM B-1955 / HRM2)
Q03MP3 1.49e-27 98 50 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q5M6A7 1.49e-27 98 50 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5M1R6 1.49e-27 98 50 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus thermophilus (strain CNRZ 1066)
Q97I46 1.5e-27 98 56 0 80 3 rpsO Small ribosomal subunit protein uS15 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q1GVQ9 1.55e-27 98 51 0 89 3 rpsO Small ribosomal subunit protein uS15 Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
A1AVW6 1.61e-27 98 56 1 89 3 rpsO Small ribosomal subunit protein uS15 Ruthia magnifica subsp. Calyptogena magnifica
A9IMS2 1.62e-27 98 52 0 89 3 rpsO Small ribosomal subunit protein uS15 Bartonella tribocorum (strain CIP 105476 / IBS 506)
Q2RMR7 1.66e-27 98 51 0 89 3 rpsO Small ribosomal subunit protein uS15 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
C6E2P6 1.72e-27 98 57 0 87 3 rpsO Small ribosomal subunit protein uS15 Geobacter sp. (strain M21)
B5EI62 1.72e-27 98 57 0 87 3 rpsO Small ribosomal subunit protein uS15 Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
Q8G448 1.73e-27 98 53 0 89 3 rpsO Small ribosomal subunit protein uS15 Bifidobacterium longum (strain NCC 2705)
B3DPW9 1.73e-27 98 53 0 89 3 rpsO Small ribosomal subunit protein uS15 Bifidobacterium longum (strain DJO10A)
B8CW77 1.78e-27 98 54 0 86 3 rpsO Small ribosomal subunit protein uS15 Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)
B9MR53 2.19e-27 98 55 0 87 3 rpsO Small ribosomal subunit protein uS15 Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
O86655 2.29e-27 98 52 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q2G5F4 2.72e-27 97 50 0 89 3 rpsO Small ribosomal subunit protein uS15 Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
Q6G0P6 2.84e-27 97 52 0 89 3 rpsO Small ribosomal subunit protein uS15 Bartonella quintana (strain Toulouse)
Q8F7J9 3.75e-27 97 52 0 87 3 rpsO Small ribosomal subunit protein uS15 Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72NX6 3.75e-27 97 52 0 87 3 rpsO Small ribosomal subunit protein uS15 Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q99XZ0 4.26e-27 97 49 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus pyogenes serotype M1
Q49X61 4.26e-27 97 52 0 89 3 rpsO Small ribosomal subunit protein uS15 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q5WT39 4.7e-27 97 51 0 88 3 rpsO Small ribosomal subunit protein uS15 Legionella pneumophila (strain Lens)
Q5ZRV7 4.7e-27 97 51 0 88 3 rpsO Small ribosomal subunit protein uS15 Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A5IHU4 4.7e-27 97 51 0 88 3 rpsO Small ribosomal subunit protein uS15 Legionella pneumophila (strain Corby)
O87791 5.18e-27 97 57 0 89 3 rpsO Small ribosomal subunit protein uS15 Pseudomonas putida
Q8E1Z9 5.24e-27 97 49 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E7F7 5.24e-27 97 49 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus agalactiae serotype III (strain NEM316)
Q3K3H0 5.24e-27 97 49 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
A8ERS1 5.51e-27 97 54 0 88 3 rpsO Small ribosomal subunit protein uS15 Aliarcobacter butzleri (strain RM4018)
A3DCH6 5.53e-27 97 55 0 87 3 rpsO Small ribosomal subunit protein uS15 Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q6G5F7 5.66e-27 97 52 0 89 3 rpsO Small ribosomal subunit protein uS15 Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q4L5X6 5.78e-27 97 52 0 89 3 rpsO Small ribosomal subunit protein uS15 Staphylococcus haemolyticus (strain JCSC1435)
A4FM23 7.2e-27 97 53 0 89 3 rpsO Small ribosomal subunit protein uS15 Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
Q02WW4 7.2e-27 97 50 0 89 3 rpsO Small ribosomal subunit protein uS15 Lactococcus lactis subsp. cremoris (strain SK11)
A2RMV9 7.2e-27 97 50 0 89 1 rpsO Small ribosomal subunit protein uS15 Lactococcus lactis subsp. cremoris (strain MG1363)
Q9CEF6 7.2e-27 97 50 0 89 3 rpsO Small ribosomal subunit protein uS15 Lactococcus lactis subsp. lactis (strain IL1403)
A7H9F7 7.36e-27 97 51 0 89 3 rpsO Small ribosomal subunit protein uS15 Anaeromyxobacter sp. (strain Fw109-5)
B5YEA9 7.6e-27 97 51 0 89 3 rpsO Small ribosomal subunit protein uS15 Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12)
B2S1E8 7.81e-27 96 50 0 87 3 rpsO Small ribosomal subunit protein uS15 Borrelia hermsii (strain HS1 / DAH)
Q82ZJ1 7.86e-27 96 50 0 89 1 rpsO Small ribosomal subunit protein uS15 Enterococcus faecalis (strain ATCC 700802 / V583)
Q8CST2 8.12e-27 96 51 0 89 3 rpsO Small ribosomal subunit protein uS15 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HPR8 8.12e-27 96 51 0 89 3 rpsO Small ribosomal subunit protein uS15 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q67P80 8.46e-27 96 54 0 88 3 rpsO Small ribosomal subunit protein uS15 Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q6AJY8 8.67e-27 96 52 0 89 3 rpsO Small ribosomal subunit protein uS15 Desulfotalea psychrophila (strain LSv54 / DSM 12343)
C0ZYB6 8.77e-27 96 51 0 89 3 rpsO Small ribosomal subunit protein uS15 Rhodococcus erythropolis (strain PR4 / NBRC 100887)
A6W814 8.87e-27 96 51 0 89 3 rpsO Small ribosomal subunit protein uS15 Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216)
C4XJA5 8.96e-27 96 49 0 89 3 rpsO Small ribosomal subunit protein uS15 Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
A1UU53 9.36e-27 96 49 0 89 3 rpsO Small ribosomal subunit protein uS15 Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
Q0BWM8 1.15e-26 96 52 0 89 3 rpsO Small ribosomal subunit protein uS15 Hyphomonas neptunium (strain ATCC 15444)
A1R0M9 1.16e-26 96 50 0 87 3 rpsO Small ribosomal subunit protein uS15 Borrelia turicatae (strain 91E135)
B8E2S4 1.2e-26 96 51 0 89 3 rpsO Small ribosomal subunit protein uS15 Dictyoglomus turgidum (strain DSM 6724 / Z-1310)
A8AV42 1.36e-26 96 48 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
C0QTM4 1.43e-26 96 53 0 88 3 rpsO Small ribosomal subunit protein uS15 Persephonella marina (strain DSM 14350 / EX-H1)
Q5NQ31 1.47e-26 96 50 0 89 3 rpsO Small ribosomal subunit protein uS15 Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
B7GNH3 1.5e-26 96 51 0 89 3 rpsO Small ribosomal subunit protein uS15 Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)
B9KCH8 1.53e-26 96 53 0 88 3 rpsO Small ribosomal subunit protein uS15 Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
B7IFB5 1.54e-26 95 54 0 79 3 rpsO Small ribosomal subunit protein uS15 Thermosipho africanus (strain TCF52B)
Q0SSD9 1.55e-26 95 61 0 80 3 rpsO Small ribosomal subunit protein uS15 Clostridium perfringens (strain SM101 / Type A)
Q8XJS3 1.55e-26 95 61 0 80 3 rpsO Small ribosomal subunit protein uS15 Clostridium perfringens (strain 13 / Type A)
Q0TPS2 1.55e-26 95 61 0 80 3 rpsO Small ribosomal subunit protein uS15 Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
A6Q424 1.6e-26 95 51 0 88 3 rpsO Small ribosomal subunit protein uS15 Nitratiruptor sp. (strain SB155-2)
A8ZZ60 1.6e-26 95 53 0 89 3 rpsO Small ribosomal subunit protein uS15 Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
B0U1R1 1.74e-26 95 56 1 89 3 rpsO Small ribosomal subunit protein uS15 Xylella fastidiosa (strain M12)
Q9PGR0 1.74e-26 95 56 1 89 3 rpsO Small ribosomal subunit protein uS15 Xylella fastidiosa (strain 9a5c)
B4UHG4 1.85e-26 95 50 0 89 3 rpsO Small ribosomal subunit protein uS15 Anaeromyxobacter sp. (strain K)
Q2IQ02 1.85e-26 95 50 0 89 3 rpsO Small ribosomal subunit protein uS15 Anaeromyxobacter dehalogenans (strain 2CP-C)
B8JFZ0 1.85e-26 95 50 0 89 3 rpsO Small ribosomal subunit protein uS15 Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
C4K0F3 1.85e-26 95 48 0 89 3 rpsO Small ribosomal subunit protein uS15 Rickettsia peacockii (strain Rustic)
C1CSP2 1.95e-26 95 48 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus pneumoniae (strain Taiwan19F-14)
C1CLW8 1.95e-26 95 48 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus pneumoniae (strain P1031)
C1CFJ7 1.95e-26 95 48 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus pneumoniae (strain JJA)
Q8CWQ0 1.95e-26 95 48 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
B2IRD4 1.95e-26 95 48 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus pneumoniae (strain CGSP14)
Q97PI9 1.95e-26 95 48 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
B8ZM28 1.95e-26 95 48 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
B1I700 1.95e-26 95 48 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus pneumoniae (strain Hungary19A-6)
C1C8L6 1.95e-26 95 48 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus pneumoniae (strain 70585)
B5E6Q4 1.95e-26 95 48 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus pneumoniae serotype 19F (strain G54)
Q04JE2 1.95e-26 95 48 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q04ZJ8 2.05e-26 95 51 0 87 3 rpsO Small ribosomal subunit protein uS15 Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04U28 2.05e-26 95 51 0 87 3 rpsO Small ribosomal subunit protein uS15 Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
Q82K79 2.07e-26 95 50 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
A6LSQ9 2.32e-26 95 57 0 80 3 rpsO Small ribosomal subunit protein uS15 Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
B2ICY8 2.4e-26 95 49 0 89 3 rpsO Small ribosomal subunit protein uS15 Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
A0JUV7 2.43e-26 95 50 0 89 3 rpsO Small ribosomal subunit protein uS15 Arthrobacter sp. (strain FB24)
Q50EJ9 2.62e-26 95 48 0 89 3 rpsO Small ribosomal subunit protein uS15 Limosilactobacillus reuteri
B2G6Q9 2.62e-26 95 48 0 89 3 rpsO Small ribosomal subunit protein uS15 Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VJ89 2.62e-26 95 48 0 89 3 rpsO Small ribosomal subunit protein uS15 Limosilactobacillus reuteri (strain DSM 20016)
A4VXR1 2.68e-26 95 49 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus suis (strain 05ZYH33)
A4W410 2.68e-26 95 49 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus suis (strain 98HAH33)
B2GBB8 2.68e-26 95 49 0 89 3 rpsO Small ribosomal subunit protein uS15 Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
B1HR10 2.71e-26 95 51 0 89 3 rpsO Small ribosomal subunit protein uS15 Lysinibacillus sphaericus (strain C3-41)
Q30SM6 2.71e-26 95 54 0 88 3 rpsO Small ribosomal subunit protein uS15 Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
B1LBY1 2.98e-26 95 50 0 89 3 rpsO Small ribosomal subunit protein uS15 Thermotoga sp. (strain RQ2)
A5IMM9 2.98e-26 95 50 0 89 3 rpsO Small ribosomal subunit protein uS15 Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
Q9X165 2.98e-26 95 50 0 89 3 rpsO Small ribosomal subunit protein uS15 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
A3CQH4 3.41e-26 95 48 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus sanguinis (strain SK36)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS09910
Feature type CDS
Gene rpsO
Product 30S ribosomal protein S15
Location 85891 - 86160 (strand: 1)
Length 270 (nucleotides) / 89 (amino acids)

Contig

Accession term accessions NZ_VXKB01000002 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 573139 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1407
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00312 Ribosomal protein S15

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0184 Translation, ribosomal structure and biogenesis (J) J Ribosomal protein S15P/S13E

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02956 small subunit ribosomal protein S15 Ribosome -

Protein Sequence

MSLSTEATAKIVADFGRTENDTGSSEVQIALLTAQINHLQGHFSEHKKDHHSRRGLLRMVAQRRKLLTYLKRKDLAGYTSILERLGLRR

Flanking regions ( +/- flanking 50bp)

AGAGATCGGCACTCATTTTGTTTATCAATCAATGTATATTGGAGTTTTTTATGTCTCTAAGCACTGAAGCAACAGCGAAAATTGTCGCTGATTTTGGTCGTACTGAAAACGACACCGGTTCAAGCGAAGTTCAGATCGCGCTGCTGACTGCACAGATTAACCATCTGCAAGGTCACTTCTCCGAGCACAAAAAAGATCACCACAGTCGTCGTGGTCTGCTGCGTATGGTTGCTCAGCGTCGTAAGCTGCTGACCTACCTGAAGCGTAAAGATTTAGCCGGCTATACCTCGATTCTTGAGCGTCTTGGTCTGCGTCGCTAATCCGACAAGTTTCAGTGGAAAGGGGCCGAAGATGGCCCCTTTTCTTCTGA